SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302877365|ref|YP_003845929.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302877365|ref|YP_003845929.1|
Domain Number 1 Region: 1073-1316
Classification Level Classification E-value
Superfamily EAL domain-like 6.28e-77
Family EAL domain 0.0054
Further Details:      
 
Domain Number 2 Region: 149-321
Classification Level Classification E-value
Superfamily GAF domain-like 4.66e-54
Family GAF domain 0.00000811
Further Details:      
 
Domain Number 3 Region: 329-510
Classification Level Classification E-value
Superfamily GAF domain-like 2.45e-49
Family Phytochrome-specific domain 0.00011
Further Details:      
 
Domain Number 4 Region: 900-1058
Classification Level Classification E-value
Superfamily Nucleotide cyclase 2.35e-46
Family GGDEF domain 0.00017
Further Details:      
 
Domain Number 5 Region: 16-127
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.11e-26
Family BphP N-terminal domain-like 0.008
Further Details:      
 
Domain Number 6 Region: 775-882
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.64e-25
Family Heme-binding PAS domain 0.043
Further Details:      
 
Domain Number 7 Region: 522-631
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.71e-17
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.061
Further Details:      
 
Domain Number 8 Region: 628-757
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000037
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302877365|ref|YP_003845929.1|
Sequence length 1321
Comment PAS/PAC and GAF sensor-containing diguanylate cyclase/phosphodiesterase [Gallionella capsiferriformans ES-2]
Sequence
MLTTEPIANAPEVEEALKNCEREAIHQVGKIQPVGLLLALNDDGLIITHVSDNVSEWFDL
TPSTLLGKTFSSLVGETQALSIRQLIGLEDWRRTAITTFKITRGGRTLSLDAQVSRTGKC
WIIEIEPDESDRDDLFHKLFIPIRDSLWQLDAEVDLFRYTQKVVEQVRLLTGYDRVMMYQ
FDDNWDGEVIAESRADDIGSYLGNHFPAADIPPQARSLYTKNLVRMISDVDAIPVQIQSQ
DSEPLDLTYSSLRALSPVHLQYLRNMGVNATLSISLIQNDRLWGLIACHHREPKYISMRV
RELDEFIGKTVSLKLSNLENGRKVQFHDQIHQLLEKLTEKIRQNCDIGSVIDIFDAELLS
LVHADGAIINLGGNRYHIGSTPSDELMLDIESWLKTMSPKGVFQTDNLSGIYPNLGVYQE
VACGLMIAPLDRNMHSYISWFRNEITKTIKWAGNPDKVVKNEQGRLTISPRESFATWVEI
FRDKSPQWTQMEIDAANSLALALIEVLTHHALEQSEENYRFLTDNSSDMIARFDLDGVYI
FLSPSCQSLFGFSAQHMTGCAVTDFIMPEDCVTFQNALLLMGSTDQAQTLLFRSQHDRSK
TVWIEYTLKRIINPRSGAIEIVANGRDVTQRHTYQLAIEDLHRRNAKILEAAGDGLVSIS
PDGKIVYTNERVRQILGWGGSELAGKSCCQLFHARDADTSHDYPCDCPLIAQNLNKEVGV
SATGYFSHKEGRAIRVDYSCTQMTDHGKLSGAVLVFRESTEQSMTFDQKQTSDVIFNAAS
EAVMVTDANRRITSVNRAFIKITGYAAEEMIGQTPKLLSSGVHTQNFYDAMYASLEASGY
WAGEIWNRRKNGEIYPQWGSITAIFGELGDLRSYIAVFSDVSKAKQAEEHLYHLANHDSL
TGLANRSKFVDYLNHTLDLARRNRGHKVAVAFIDMDRFKIINDTLGHTIGDQFLKAIATR
ISSQCRNEDLLSRWGGDEFVLVMDRVDGPDSVAEAVRRMMEVVRKPLLIDGHELEPTLSV
GISFFPDDAQNTTDLVKAADTAMYRVKENGRNGYAFFTELQADESKKKFEIVSELNRALR
LNEFVLNYQPQVKPDTGEIVGLEALIRWEHPERGYLSPANFIPLAEELGMINQVGEWVIK
AVCQQMSAWKLGGVTYPRVAVNVAPSQLDSGLADYVQRTLALYGLTADCLEIELTEGALE
RGGEVAPVLKQLRELGITLSIDDFGTGYSSLGHLKNFPINCFKIDKSFVDGLPDSVQDAA
IVKTILTLGENLNVEVVVEGVETLAQRDFLTSIGAKIIQGYCYGKPLSVEKITERLKIGH
F
Download sequence
Identical sequences D9SIA8
gi|302877365|ref|YP_003845929.1| WP_013292108.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]