SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302877570|ref|YP_003846134.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302877570|ref|YP_003846134.1|
Domain Number 1 Region: 7-112,212-307
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 7.65e-46
Family MraW-like putative methyltransferases 0.00028
Further Details:      
 
Domain Number 2 Region: 113-212
Classification Level Classification E-value
Superfamily Putative methyltransferase TM0872, insert domain 1.11e-33
Family Putative methyltransferase TM0872, insert domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302877570|ref|YP_003846134.1|
Sequence length 311
Comment S-adenosyl-methyltransferase MraW [Gallionella capsiferriformans ES-2]
Sequence
MSEVLVHTTVLLAEAVEALAIKPDGIYLDCTFGRGGHSALILQQLGANGRLIALDKDMTA
VSHGLEWQDARFKMVHSGFTHLAEVLRELGVERVDGILLDLGVSSPQLDEAARGFSFRFD
APLDMRMDNSRGPTAAQWLETADEGLLTEVIRDYGEERFAKQIARAIIVAREIQPIQTTG
QLVELVGKTVRTRETGKNPATRTFQAIRIYLNQELEELKQVLPQCVTHLKPGGRLAVISF
HSLEDRMVKHFIRDMNDADKLPRNVPIRASEVPKGKLNLIGRAIKAGKDELNSNPRARSA
VMRVAERSDVA
Download sequence
Identical sequences D9SJM2
gi|302877570|ref|YP_003846134.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]