SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302877613|ref|YP_003846177.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302877613|ref|YP_003846177.1|
Domain Number 1 Region: 378-520
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 7.47e-29
Family Histidine kinase 0.0051
Further Details:      
 
Domain Number 2 Region: 299-373
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000000314
Family Homodimeric domain of signal transducing histidine kinase 0.0034
Further Details:      
 
Weak hits

Sequence:  gi|302877613|ref|YP_003846177.1|
Domain Number - Region: 201-233
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00144
Family Heme-binding PAS domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302877613|ref|YP_003846177.1|
Sequence length 534
Comment multi-sensor signal transduction histidine kinase [Gallionella capsiferriformans ES-2]
Sequence
MLPVTNDEIPADFWRSLYYFNLYRLALVGFILFIAIAFEAERLFGTSKGHLFLLTGWVYA
VVVTLSFIPMRMRWFKFSWQLAWQVCSDIVVLTVLSHASGGIQSSVGLLLMVSMAVAGII
SRGKITLFFASLASIAALLEHAFAVLYDDAPVTQYVQVGLLCVSYFAVAGLAHKLAQYAL
DNQKLAQRRGRDLIGMAEANRLVMRDMQDGVLVVDEHDRIVQMNPSAARLLYNTEAADSM
LSESFPLLYQQYVQWKHNTMNARITLQLDGGLQARLRFVGVERDAAQGAVIFLEDMQHAQ
AEAQQIKLAALGRLTANLAHEVRNPLSAISYATELLQEESGDTRQARLLQLIRDNTQRIN
RIVEDVMQLNRRDRAQPETFDLAVLLPVFVEEFNQAERVGKDVLHLQAEGGSMVTFDRGH
FRQVLWNLCRNALHYGHQLPGSLVLTTGLDRGRVLLDVLDDGPGVSVAHQSRLFEPFFTT
AEQGTGLGLYIARELCEANGAWLEYHDRFSEPGACFRITFGERRLGKRPVNEHG
Download sequence
Identical sequences D9SJR4
gi|302877613|ref|YP_003846177.1| WP_013292356.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]