SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302877626|ref|YP_003846190.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302877626|ref|YP_003846190.1|
Domain Number 1 Region: 507-677
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.06e-44
Family Histidine kinase 0.0012
Further Details:      
 
Domain Number 2 Region: 706-824
Classification Level Classification E-value
Superfamily CheY-like 2.99e-35
Family CheY-related 0.0034
Further Details:      
 
Domain Number 3 Region: 27-161
Classification Level Classification E-value
Superfamily GAF domain-like 1.79e-25
Family GAF domain 0.052
Further Details:      
 
Domain Number 4 Region: 438-519
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 5.3e-20
Family Homodimeric domain of signal transducing histidine kinase 0.001
Further Details:      
 
Domain Number 5 Region: 327-435
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.69e-19
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.078
Further Details:      
 
Domain Number 6 Region: 209-308
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000114
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302877626|ref|YP_003846190.1|
Sequence length 834
Comment multi-sensor hybrid histidine kinase [Gallionella capsiferriformans ES-2]
Sequence
MKIAPLPKDEQARMAALLDYEVLDTELDSALDSMVQLASYICQTPIAAISLIDEHRQWFK
ASTGLDAKETSRDVAFCAHTILENETMIIENAQLDERFFDNPLVVSAPEIRFYAGVPLAA
PEGQHIGTLCVIDRVPRVLSPEQINAIKILANNIMAHLNLNLSHRMSRQHVDSLNLKNAQ
LQTSQNLLTKLSHQLPGMLFQFRLFPDGNVSMPYASDGIFEIFELPAVQIKEDASLLFTR
VHPEDYEILMASIHESARTQQPWRLEYRVMLPMRGLRWLEGQSRPEKLSDGSVIWHGYLS
DVTERHQAAVSLHEVSERLALATQAGGVGVWDWDVVNNALTWDDQMFALYGLHRDQFVGA
AEAWSSAILPEDTAQAQACMHNALANKQHYDTEFRVRWPDGSIHNIRALASVKFDSAGKP
LRMTGTNWDITELKQSQQALQRAKEVAESLAQSKSEFLANMSHEIRTPMNAVIGLSELAL
DSTDPAEKQSHLQQINDSSRSLMGILNDILDLSKIEAHQLSVEKIQFNLTELLDSIQRIF
TLSAAGCDIEFNVVRDADIHQLLLGDPLRLRQILTNLLGNAFKFTQKGRVTLNVSKIENT
TDSTTLRFSVKDNGIGMSDGQVSTLFQPFSQADSSISRRFGGTGLGLTISRNLAQLMGGD
IKVESQAGAGSTFSVELTFSKVQVSDPQRRQSDKAPPELREIAHALRGKHVLLTEDNRIN
QLVASKMLEKIGLLVDIANNGEEAIQRLQEKTYDIVLMDIQMPVMDGLEATRLIRQDTRF
INLPIVAMSAGVTLDEKSACDKAGMTGFVAKPINSSELINKLIELCFPYISDGI
Download sequence
Identical sequences D9SJS7
gi|302877626|ref|YP_003846190.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]