SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302877713|ref|YP_003846277.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302877713|ref|YP_003846277.1|
Domain Number 1 Region: 179-354
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.85e-39
Family HD domain 0.028
Further Details:      
 
Domain Number 2 Region: 386-511
Classification Level Classification E-value
Superfamily Hemerythrin-like 2.75e-25
Family Hemerythrin-like 0.0017
Further Details:      
 
Domain Number 3 Region: 48-164
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000153
Family GAF domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302877713|ref|YP_003846277.1|
Sequence length 515
Comment metal dependent phosphohydrolase [Gallionella capsiferriformans ES-2]
Sequence
MNKEEGMLAISKLVFELTITSTTTADLDILLQRLFSILDSYYDLQLEARGAILLLNPRGR
YFQVAQFGMDPAWTNKMRWDAPAFTRPHISAHCLLQDSLPSLELPTPAHMLLLPLHIEGK
GLGYTVLFVPENYLMSETHCEFMEDLARALSSLVNRALTNEILRIRKLELEESRADVIRS
LGVASEYRDNETGLHIMRMTNFAQAIAKSLGIPDAQRELLYIAAPMHDVGKIGIADAVLL
KPGKLTPEEFTIMKTHTDIGVTILEGKDELIAAARDIAGCHHERWDGNGYPNGLVAEQIP
LLARICAVADVFDALTSSRPYKTAWTVEDAYNWVISESGKHFDPAVVAAFDAAMPDILRI
RELYRDDIIDPKQVLTLPPIRRRENAWIPWDEKLSIGIDVIDEHHRYLFDLINDLYEVVA
NKRGAREVARLIKSLDAYAKIHFRAEEQMMNHYAYTRIDRQLSQHHAFEEKIAEFYEELH
DNPFVAQFDALAYLREWLIHHILVEDIQLVELTRK
Download sequence
Identical sequences D9SC48
gi|302877713|ref|YP_003846277.1| WP_013292456.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]