SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302877756|ref|YP_003846320.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302877756|ref|YP_003846320.1|
Domain Number 1 Region: 280-447
Classification Level Classification E-value
Superfamily Nucleotide cyclase 7.32e-35
Family GGDEF domain 0.001
Further Details:      
 
Domain Number 2 Region: 152-267
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.61e-24
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.031
Further Details:      
 
Domain Number 3 Region: 9-143
Classification Level Classification E-value
Superfamily CheY-like 5.41e-22
Family CheY-related 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302877756|ref|YP_003846320.1|
Sequence length 449
Comment response regulator receiver modulated diguanylate cyclase with PAS/PAC sensor [Gallionella capsiferriformans ES-2]
Sequence
MSDNSVLSVKILAVEDDTGDYGLIRVYLRMAGYIQNIVPDPVTWVTTLAQAEQQVVLDRP
DIILLDLSLPDSFGISTVKRMRMLLPTVPIIVLSGNNDNDIALAALEEGAQDYVIKGQYE
HNALGKAISHALIRAKLEAKLIESEFRWKFAIEGSGDGLWDWDVAQNIVFYSERWKQMLG
YAENEVGNGLDEWEMRIHPDDKAGTLASVQAYLTGKSSSYLSEHRVLSKDGDYKWILDRG
MVVARDAEGHPIRLIGTHTDITERKRMEDQVRQLAFYDPLTQLPNRRLLNDRLSRAMSAG
KRSGGYGALMFLDLDNFKPINDTHDHILTIEAANRLRACVREIDTVARFCGDEFVVMLSE
LDTNEQASTIEATRVAEKILACLSTPYQLTVKHEGQPDTEVEYHCTTSIGLVLFLGHEIC
QDDIIICANAAMYQARHAGRNTIRFYQAE
Download sequence
Identical sequences D9SC91
WP_013292499.1.12990 gi|302877756|ref|YP_003846320.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]