SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302877880|ref|YP_003846444.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302877880|ref|YP_003846444.1|
Domain Number 1 Region: 329-486
Classification Level Classification E-value
Superfamily Nucleotide cyclase 2.28e-47
Family GGDEF domain 0.00017
Further Details:      
 
Domain Number 2 Region: 9-136
Classification Level Classification E-value
Superfamily Hemerythrin-like 1.83e-23
Family Hemerythrin-like 0.0036
Further Details:      
 
Domain Number 3 Region: 209-308
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.63e-18
Family Flavin-binding PAS domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302877880|ref|YP_003846444.1|
Sequence length 491
Comment diguanylate cyclase with PAS/PAC sensor and hemerythrin-like metal-binding domain [Gallionella capsiferriformans ES-2]
Sequence
MNLMNESIEVFPWNDNFSTGIPLIDEQHKRLIHLINLLACGLAYQSDTAELDRIFSELAD
YAVYHFKTEEAVWHAHLADDEWEVEHQHSHNRFVTDLLELKSKKENATVNETLKDILSFL
THWLAFHILESDKHMSKVALGLQAGMTLTDAKLQASADMSGSMKVLIETVLSMYDTLSSR
TLELIKEVIDRQKAEAKLRLAANAIENTLEAICITDHCANIIDANPAFQQITQQPLDALI
GKNLRLLKSGLDDDLVFANIMEKLAEEGHWSGEIKSRSNSGETYTDWLTLSTIKEENGAI
CNYVGIFSNFSRLSGQWQELQHMANHDALTGLPNRLLLADRMELAMAHAERTGSFLAVCY
LDLDNFKPVNDTLGHTAGDLVLREISKRLQSHLRLNDTVSRVGGDEFVILLNDLHKPDDF
EELLVRILQEICLPIGIREQNVFVTGSIGVTQFPHDKGEAAMLLAHADSAMYQAKNLGKS
RYQLYDITKEN
Download sequence
Identical sequences D9SCZ1
WP_013292622.1.12990 gi|302877880|ref|YP_003846444.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]