SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302877988|ref|YP_003846552.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302877988|ref|YP_003846552.1|
Domain Number 1 Region: 86-145
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000746
Family Homodimeric domain of signal transducing histidine kinase 0.0036
Further Details:      
 
Domain Number 2 Region: 5-78
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000895
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302877988|ref|YP_003846552.1|
Sequence length 163
Comment histidine kinase A domain-containing protein [Gallionella capsiferriformans ES-2]
Sequence
MSEHERAAWHSNPWGMAAIDISGRVSAVNPVFEYSTKLSAAQLIGLSEADFDHILSDLPF
TDRSRINVTDGSIRAIHYVRCQECTERDHTLSRIAEVLREPLASIYGFAELLLTQHYDEQ
TRQDLTAMLLGQAEVMANLINERLENRTLWSRASENQLSEDSR
Download sequence
Identical sequences D9SDN1
WP_013292729.1.12990 gi|302877988|ref|YP_003846552.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]