SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302877991|ref|YP_003846555.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302877991|ref|YP_003846555.1|
Domain Number 1 Region: 735-904
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.5e-42
Family Histidine kinase 0.0016
Further Details:      
 
Domain Number 2 Region: 1072-1206
Classification Level Classification E-value
Superfamily CheY-like 2.99e-39
Family CheY-related 0.0017
Further Details:      
 
Domain Number 3 Region: 922-1048
Classification Level Classification E-value
Superfamily CheY-like 8.4e-28
Family CheY-related 0.0081
Further Details:      
 
Domain Number 4 Region: 667-747
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 7.26e-22
Family Homodimeric domain of signal transducing histidine kinase 0.0015
Further Details:      
 
Domain Number 5 Region: 1170-1183,1215-1315
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 5.89e-16
Family Phosphorelay protein-like 0.092
Further Details:      
 
Domain Number 6 Region: 549-668
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000286
Family Heme-binding PAS domain 0.024
Further Details:      
 
Domain Number 7 Region: 339-491
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000000249
Family GAF domain 0.0091
Further Details:      
 
Domain Number 8 Region: 207-257
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000471
Family HAMP domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302877991|ref|YP_003846555.1|
Sequence length 1407
Comment multi-sensor hybrid histidine kinase [Gallionella capsiferriformans ES-2]
Sequence
MTLAQRFNVLFLLAAAGMTGLAGINLIQFNHVYETVNTSNVKIIPSLLLLDDAAKAFGRL
RVGLYQHVLHHDASRLSDVEVLIIQSQADLNTALNKYELYLFDEKDRLLLSEDIKAVHDY
TEHIEKIKAASHNHHDNEALILLNEASPLADRINQVLESHKNFKSTLGKKIAAEGLEIKY
NTVTISITVWASILTLVLLIGVWLRRTLLHALEKATQVAEHIAAGDLSYRLNISGNDESS
HLLSAMMSMQSNLRALIGDLSNIVEAAASRGEFNVRMSLSDKSGYAQDISKLVNNLSDIT
DTGMRDVIRVARAIDQGDLTQTISANYPGLFGEVKEALLSMQEVARALEQRRWAKDEITN
LISAIQQSRSHSEFGEALLSHLCPTVHAVQGCLYVQTEESLSPVSAYGARIDQINPSGLI
EQCAQDQKMIAIEDPEARLHLSGLLSARTAHVVILPLVLQNRAIGIIELSLLSPPDAHCS
LLLSELPQMLAPVLEVLRRNLRTQHLNMMLAAQTKELDAQRRELLNTHEATGKVNAMLQD
ILAAATEIAIIGTDVNGLITLFNTGANKMLGWIADEVVGLQTPACFHREDELAAACRTAD
VSSSFGAIVAGAVMNGHDSREWTFVRHDGTEFIGLLLTSAVYSMDSVISGYLCVIQDISG
RRETEQNLINARTLAEETSRMKSDFLANMSHEIRTPMNGIIGMSHLALNTDLTPRQRDYL
KKIQQSGQNLLRIINDILDISKIEAGKLSIEHSEFELENTLADVVALIGEKTTEKGLELI
LDIASDVPVNLLGDSLRLGQVLLNYASNALKFTEQGEIVIAVRLRERSEDQVLLYFEVRD
TGIGLSSEQISRLFTPFTQGDASTTRRYGGTGLGLAICRQLADLMGGEAGVNSVEGQGST
FWFTARLGTGGIKKRTLLPVADLRGGHVLVVDDNDNARQVMNEMLDGMSFSVDVANSAIE
AITAIELADRQRDPYKLVFMDWHMPTMNGIDACNKIQSLPLTAPPHLVLVTAYGRDEVFH
NAENAGIRDVLVKPVTASTLFDTAIRVIGAEREDLHISCVPTQPAEDMNTISGARILLVE
DNEFNQQIAMELLQQMHLAVDLAENGAEALNLLEKNNYDLVLMDMQMPVMDGISATLELR
RQARFAELPVVAMTANVLQADRQRCLDAGMNDFLSKPIEPELLWQTLLKWITAYRSQVKP
VAKPDRQAFDPEIEGIESIPALRRMLGNTELYFSALRKFCELQQPTPEQTRAALAINDWA
SAQRHIHTLKGVSASIGAKELAKDAALLEQGLSERWPKDEIDSRLEALESALNELIGRVL
PRLPVPASSQPADSASGINALAELKLLLTENNPEAMSWFDSNSHTLKGLFPEKQLTKLST
AIHLCDLDSALAILKNASPESANESLT
Download sequence
Identical sequences D9SDN4
gi|302877991|ref|YP_003846555.1| WP_013292732.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]