SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302877992|ref|YP_003846556.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302877992|ref|YP_003846556.1|
Domain Number 1 Region: 477-630
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.54e-33
Family Histidine kinase 0.00042
Further Details:      
 
Domain Number 2 Region: 137-267
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.79e-23
Family Flavin-binding PAS domain 0.058
Further Details:      
 
Domain Number 3 Region: 393-470
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.47e-19
Family Homodimeric domain of signal transducing histidine kinase 0.00047
Further Details:      
 
Domain Number 4 Region: 15-138
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000489
Family Heme-binding PAS domain 0.06
Further Details:      
 
Domain Number 5 Region: 265-328
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000117
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302877992|ref|YP_003846556.1|
Sequence length 640
Comment PAS/PAC sensor signal transduction histidine kinase [Gallionella capsiferriformans ES-2]
Sequence
MTKQENEINALNEHKLRSELVRAYDLLRTVIDENPNIILMKDWDGKFLIGNRALANLYGT
TPENLEGKDDGAFNPNAEQVAFYLQNVREIMSQPATQIVMEESTNNATGETHYYQSIKKP
LVSADGKKQILVIANDVTELKLAQKKLEESERRLRYVLDATGEGVWDWDIKSGIVTHNSQ
WCKIAGMDDNYLQHPVEEFGQLLHEDDRARVFDALQNCLNGHGHYQSEHRMRMPGNRIVW
VLDRGDVVERDSEGTALRMVGSFVDITKRKEIELALGVRTELLDAIFELSPDGFISFDEA
HCISYVSPAFTRMTGLHAAQLQGMNEAQFSDLLTRLCVAGTHFKGVQKLRAPASDKLPDT
RQIIELSHVGKRILEVGLRSSTTSSVSQILYFREITHETELDQLKSEFLSTAAHELRTPM
ASIYGFAELLLSHDFDEESRREFLTIILKQSELMTSILNELLDLARIEARRGKDFVIEIL
PAQALITQVVRSFILPEGRRAPALKMPGTTVFLMADHKKTYQAIVNVLSNAYKYSSGEVN
IELINEPQPASLSTAAVGIRIIDCGIGMTPEQQSRVFERFYRADSSGKITGTGLGMSIVQ
EIVLLHGGQVTLESTIGKGTSVTLWFPAESNLPSTAGLTS
Download sequence
Identical sequences D9SDN5
gi|302877992|ref|YP_003846556.1| WP_013292733.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]