SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302877993|ref|YP_003846557.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302877993|ref|YP_003846557.1|
Domain Number 1 Region: 436-601
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.44e-37
Family Histidine kinase 0.00075
Further Details:      
 
Domain Number 2 Region: 371-446
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 5.49e-20
Family Homodimeric domain of signal transducing histidine kinase 0.00067
Further Details:      
 
Domain Number 3 Region: 243-303
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000286
Family Heme-binding PAS domain 0.074
Further Details:      
 
Domain Number 4 Region: 175-222
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000131
Family HAMP domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302877993|ref|YP_003846557.1|
Sequence length 604
Comment multi-sensor signal transduction histidine kinase [Gallionella capsiferriformans ES-2]
Sequence
MRIRTKTILGIATIELVLLAILVGSALSVLRESNEAELMRRVQLGGVLLASAAKDAVISQ
DLATLDSLVIEAMNSGQIDMVRIVDADGVILAQRGDAAVLARPFHKEVHPDQVNDGILDW
SSTVSAGGIQHGEVQLGIAIAPLTALLNSARHWAAGIASLEMLLVALFSWLLGSYLTRQL
IALREASKTFSNGNFDHRLPISGDDELTQTATAFNLMAQKIGESHIQLINENQLRVQSQQ
DAEQAQALAEDIASQLKEIFALSPDGFVSFNGEHLVKYVSPAFSRLTGLTEEDVIGINEI
TFFDRLKGRCIKGADFPDIATLHDNQTSLTDRTPVKKRQRQIIELSNGRILEIGLRESKS
ETVSQILYLRNITHETEVDRLKSEFLSTAAHELRTPMASIYGYSELLLTREFSHDEQHEF
LSTIYRQSELMISIINELLDIARIEARGSLDFTLTQIDLYDLLNNIIAGCKPPNGRKCPQ
QPQRSTPLWVAGDRRKLTQAISNVLSNAYKYSSDEVGIEFLTSDLSGHLIGLRISDRGIG
MTAEQLSHVFERFYRADDSGKFPGTGLGMSIVQEIITLHGGHIDIESQSGTGTIVTLWIP
AATD
Download sequence
Identical sequences D9SDN6
gi|302877993|ref|YP_003846557.1| WP_013292734.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]