SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302877998|ref|YP_003846562.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302877998|ref|YP_003846562.1|
Domain Number 1 Region: 467-638
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.36e-45
Family Histidine kinase 0.00069
Further Details:      
 
Domain Number 2 Region: 667-786
Classification Level Classification E-value
Superfamily CheY-like 2.85e-39
Family CheY-related 0.0038
Further Details:      
 
Domain Number 3 Region: 3-138
Classification Level Classification E-value
Superfamily CheY-like 3.27e-32
Family CheY-related 0.00067
Further Details:      
 
Domain Number 4 Region: 267-373
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.42e-28
Family Flavin-binding PAS domain 0.0052
Further Details:      
 
Domain Number 5 Region: 399-479
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 7.65e-22
Family Homodimeric domain of signal transducing histidine kinase 0.0016
Further Details:      
 
Domain Number 6 Region: 154-262
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.73e-19
Family Heme-binding PAS domain 0.034
Further Details:      
 
Domain Number 7 Region: 766-779,814-893
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 2.22e-18
Family Phosphorelay protein-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302877998|ref|YP_003846562.1|
Sequence length 918
Comment multi-sensor hybrid histidine kinase [Gallionella capsiferriformans ES-2]
Sequence
MQFTVLVVDDNAINLSLIAQLLLKIDGVSPVSFTDAMQAIIWCESNAPDLLLVDYMMPVL
DGLEFIKRFRALPGKMMVPVIMVTAAIEREVKLRALELHANDFINKPLDTVEFTARVRNM
LALRKMQLKFNEVNFEQIRQHELQYRAVIETSKDGFLVVDMQGRILETNDAYACLSGYSA
EELVTMNIGDLEAKMSASDVAHVLTGLAEQGHARFETQHKTWSGHIWPVEINVTYIAAEG
GRCFSFLHDISQRKQDEAQLRKLSQAVEQSPNSNVICDTNGVIEYVNAAFTAITGYSASE
AIGRKTGFFKSGLTQPEVYAALWQTLQQGEVWQGEFINRRKNGEDYTDFAIVSPIRQADG
EITHYVAIQKDITQKKLMDEELEIYRRDLEALVVKRTSEMFEAKTQAEAANKAKSEFLAN
MSHEIRTPMNAIIGFNELCLRTQLSDKQKDYLTKAGSAAQSLLHIINEVLDLSKIEAGQH
MLEAIPLKISRVVKNVTDLIGVLAVDKGLTIHVDLDEHIEQYPLRGDPMRLQQILLNLCS
NAIKFSTQGSISIRCQLGAISGQAVELKFAVQDSGIGISPAQLGLLFKPFSQADSSTTRR
FGGTGLGLSICRGLVERMGGRIWVESEPGIGSTFCFTVRFVIGGAPSGELLAQAHSREQL
EQKMTSLRGSRVLLVEDNAFNQQVMGEMLRDVGLQFDLAENGQDALDQLARSHYDVVLMD
LQMPVMDGLTACERLRSNPAYQNMPVIALTANVDQSDKDRCIQAGMSDHLSKPVVPEQLY
SALLRWIVPVKSIVDAPLVASPIVADESELPDLPGINAGPVIKRMRGNVPAYLRLHGLFC
QQAQGVPRALREAMAAEDFDAARRLVHTVKGSAGTIGADQLSAAAAVLEQAYRLSVPAGE
VQLSEFETALAIVMAGQL
Download sequence
Identical sequences D9SDP1
gi|302877998|ref|YP_003846562.1| WP_013292739.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]