SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302878010|ref|YP_003846574.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302878010|ref|YP_003846574.1|
Domain Number 1 Region: 375-684
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 7.85e-65
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000324
Further Details:      
 
Domain Number 2 Region: 20-113
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.43e-24
Family Flavin-binding PAS domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302878010|ref|YP_003846574.1|
Sequence length 684
Comment methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor [Gallionella capsiferriformans ES-2]
Sequence
MKKNLPVTQREINYSETMVFITKTDTKGLITYANDSFIDISGFSGEELLGHNHNVVRHPD
MPEWAFENLWGTVKAGYPWSGIVKNRAKGGDHYWVKASVSPIKENGNIIGYISLRKKPTR
QEVEAAEHLYRGKPPRAHKQDGRNYFGNLPLHAKLQLLIQPVLFVFLILSALTTAVNMDD
QLHHNAHHAAESIANEMLDSANLMMVTGQIGDPETRKLMLHKISESNDLLALQLIRSNHV
NKQYGAGLPEEQIQNDIQRQTLLHGQSYFAIDRTGGGAVLHAIIPYAGSRAHGGTDCLSC
HEAPEGTILGAADLRINLDEEYQAFYLFIAKLFAGQVFAQVFLFFFIRWAVSRYVSTPVR
SINGHLENLVNGNSDMSNHTAINGRDEMGNILCSVQSTKVLVGSVIDQITAAASQVKERS
ARLNNAVEKLSDASLTQSDASSSMAAAVEQMSVRMDQIASNAQEVMDISVSSKRLADNGK
QVVEQAVHSIEETNTSIHGVAETIRELGEKSAQVQDIVNIIKAIAAQTNLLALNAAIEAA
RAGDHGRGFSVVADEVHKLADQTSSATQEIQLMIDNFRETAEHAVDEMSVVIGKMESGAA
LTTKAGESIVEINAGASHVLAGIKDILYSLKEQAAAGQNIASNVEKVAQIAEDNRAAVGS
VDRTAEKLSSFSRDLQLSVAHFKI
Download sequence
Identical sequences D9SDQ3
WP_013292751.1.12990 gi|302878010|ref|YP_003846574.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]