SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302878069|ref|YP_003846633.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302878069|ref|YP_003846633.1|
Domain Number 1 Region: 891-1137
Classification Level Classification E-value
Superfamily EAL domain-like 1.44e-93
Family EAL domain 0.0018
Further Details:      
 
Domain Number 2 Region: 717-875
Classification Level Classification E-value
Superfamily Nucleotide cyclase 5.65e-35
Family GGDEF domain 0.00068
Further Details:      
 
Domain Number 3 Region: 1150-1268
Classification Level Classification E-value
Superfamily CheY-like 5.27e-31
Family CheY-related 0.0041
Further Details:      
 
Domain Number 4 Region: 597-698
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.54e-29
Family Flavin-binding PAS domain 0.04
Further Details:      
 
Domain Number 5 Region: 130-257
Classification Level Classification E-value
Superfamily CBS-domain pair 6.32e-26
Family CBS-domain pair 0.00078
Further Details:      
 
Domain Number 6 Region: 1-117
Classification Level Classification E-value
Superfamily CBS-domain pair 1.23e-25
Family CBS-domain pair 0.00063
Further Details:      
 
Domain Number 7 Region: 429-578
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000000000048
Family GAF domain 0.031
Further Details:      
 
Domain Number 8 Region: 278-398
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000725
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302878069|ref|YP_003846633.1|
Sequence length 1275
Comment response regulator receiver modulated diguanylate cyclase/phosphodiesterase with PAS/PAC sensor(s) [Gallionella capsiferriformans ES-2]
Sequence
MTIANIMTRNVAQIDLRQPMSVATEMMQRMQISCLLVIENNLPVGILTERDVVRGTASGF
TTAQPVAELMSTPLRSIEQTASKSEAYHTLIKHGIRHLRVIDEHGNTTGIVSETDFRNQA
SIEHFLQLRDVGSAMSADILMLSEQASVADAANAMTKSRTDYVLVGENRCTTGILTERDI
VRLFGQDDPRRVLREVMSKPVAKVARQTQLKDAAKKMQDEGIRRLVVEDDAGQVIGVLTE
HDVVKPLEEDYVDILQAIIDSQSIKLNQLQADMLNRQLAESIMAWKRPFLDLLDNLPLKV
FIKDTRSNYIACNKSYADDLGIQQSEIAGKSDLDFYPASLAQHYREDDARVIESDQTITM
VGPYLAGSRQTWVQISKSPWHDGRGDIGGVIGIFQDVTHEYQMNKALQRKAQLYEVSSQV
NSAIIHLQDTQSLLDKVCDIILSFSGFRLAWIGRENSEQQVVPVAIAGQARDYVSDLSLS
TQTGLPGAQGPAATAINENRIVVVDDFLNDPMSLAWHEAAAQYALHGNISLPINAPDFRG
ALMVYADTVNFFDHEVILLLKELSEDISFALKQIHINTIKRQQETELKLAEQVFSRSADA
MIITNPDNNIVRVNQAFCEITGYTSEEVIGKNPRILKSEKQDHDFFRSLWRSLELQGSWQ
GEIWNRRKNGEIYPEWSSINAVKDASGRVVNYFAVFSDLLQKKALAELDHLKHYDALTDL
PNRALLEDRIESSITHARQYERFIGVIFLNLDHFHTVNDMLSHAGGDQVLIATAKRLMDA
APAQASISRLSADTFVIALPDLNTSEEINRTAELIAQKIYQPLTVADQSVQLSARMGISV
YPIDGNDATTLMKHADAALADAKQCGVRNSFRFYSSSMNEHAHKLLTMGAELRNAISQNR
LVLHYQPQVDIITGQIIGAEALIRINHPERGIISPGEFISVAEETGLIIPMGTWVIREAC
RQMQQWHLDKNIELTIAINLSPLQLHQSDLPEIVSLALHDSGLNARYLELEFTESAIMKN
VRETVAIMNKFKAMGLHLSIDDFGTGYSSLSYLKQFPVDKLKIDQSFVSNITQDPNDAAI
VQAIIALGRTLGMTTIAEGVETEAQLGYLRSVNCKEMQGYLYSAPLPAEEFAALLVRGKM
MADNKSEKILLLVDDEENVLLSLKRILRREGYQILTATSAEEGLEIMAKHQVNVVLSDQR
MPGMSGVEFLRRVKTMHPNVVRMILSGYTEIGTLTDAINKGEIYQFITKPWENEALTAMI
REAFVRYEILKRPVE
Download sequence
Identical sequences D9SE93
WP_013292810.1.12990 gi|302878069|ref|YP_003846633.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]