SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302878072|ref|YP_003846636.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302878072|ref|YP_003846636.1|
Domain Number 1 Region: 416-572
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.83e-41
Family Histidine kinase 0.0017
Further Details:      
 
Domain Number 2 Region: 6-115
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.68e-19
Family Heme-binding PAS domain 0.015
Further Details:      
 
Domain Number 3 Region: 148-295
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000000169
Family GAF domain 0.04
Further Details:      
 
Domain Number 4 Region: 318-358,394-423
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000216
Family Homodimeric domain of signal transducing histidine kinase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302878072|ref|YP_003846636.1|
Sequence length 574
Comment multi-sensor signal transduction histidine kinase [Gallionella capsiferriformans ES-2]
Sequence
MDESFDALVKLENQFNFLLRFANDIIFLMDDEGCILEANDASVQSYGWSLEELLSRNIRD
LQDPAAPVPGCKAAGVLFETRHMRRDGSTFPVEVSRRLFEHEGRTYQQCIVRDITQREKM
QSRLARDAKRFEGLLKLNEAASEMPEKEFMQFGLEWVETLTSSKIAFIHFVNDDQESIEL
VAWSKATREQYCTAEYDTHYPAAQAGIWADSLRQRQAVIFNDYANYSDKHGLPEGHSALF
RLISVPVVEGEKVRVILGVGNKETDYDSEDVEIARLFGNDMWRIIRRQRLEAELTSNLEH
QRALNKKLEEAQSHLLQSEKMASLGQLSAGVAHELNNPIGFVYSNMGALEVYLNDIFSIN
SAYEALELESDTDSKALEQVRQLKRTVDYDYIKQDIFQLMSQSKDGLARMRKIVQDLKDF
SHVGEEGWQWADLHKGLDSTLNIVWNELKYKCRIVKEYGTLPQVYCMASQINQVFLNLLV
NAGQAIQNSGVITIRTGAEPDGVWVEIADTGQGMTSEQMRRIFEPFYTTKPVGEGTGLGL
SLSYGIIQKHNGRIEVKSELGKGSVMHIWLPKTV
Download sequence
Identical sequences D9SE96
WP_013292813.1.12990 gi|302878072|ref|YP_003846636.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]