SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302878206|ref|YP_003846770.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302878206|ref|YP_003846770.1|
Domain Number 1 Region: 658-905
Classification Level Classification E-value
Superfamily EAL domain-like 1.31e-89
Family EAL domain 0.0016
Further Details:      
 
Domain Number 2 Region: 487-644
Classification Level Classification E-value
Superfamily Nucleotide cyclase 7.77e-52
Family GGDEF domain 0.0000839
Further Details:      
 
Domain Number 3 Region: 344-469
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.55e-21
Family Heme-binding PAS domain 0.065
Further Details:      
 
Domain Number 4 Region: 216-345
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.42e-21
Family Heme-binding PAS domain 0.022
Further Details:      
 
Weak hits

Sequence:  gi|302878206|ref|YP_003846770.1|
Domain Number - Region: 35-154
Classification Level Classification E-value
Superfamily Diaminopimelate epimerase-like 0.0138
Family Proline racemase 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302878206|ref|YP_003846770.1|
Sequence length 908
Comment PAS/PAC sensor-containing diguanylate cyclase/phosphodiesterase [Gallionella capsiferriformans ES-2]
Sequence
MDRRSGQIGRIHRLMWGVVGSVLLTVALGGYWFTQVVAQLGTAARQERVQLLALEAAVGE
AMAELSEQTQEWKDILLRGHDPVLREKHQHAFEAHALSLGAELVSVQHAARELGLDTDDI
AEFSRQHQALMTDYRAALTLFDPKNPLSFRLVDQRVQGRDRLLRDGLRREREKLEVQIAA
REQRLSERGVLGQQWLKLGALAAFLPLLSLWFFWQVYRALREIVLSDARIRAIYQAIGDA
VLVADMQGRVESINATAQKLLGWREGEARGRLISEVFELYDVHHQQRVESPAESVLRDGC
PIPMSNGMMLRRRDGSELAVEDSAAPVRDEHGQAVGVVMVFHDVSKRYALLAELRAARAQ
FETLFEQLPEGVLLFDENLAVIMHNREAARLLEYSSKETLQLRVFDIEAMDDQAAIVARR
EKLQQTGRDDFESRYRTRSGRLLEVDVSVQVVQLPDGRIAFQTLFRDITEQKQAALQIEH
LAYHDQLTGLPNRRLLHDRLSHAISSAVRRDAQLAVIYLDLDHFKDVNDSLGHGTGDALL
QVVAERLLGCIRADDTLARMGGDEFVLMLNDLNDADSASTAAEKIMHELSRPVCIGGDEL
RITPSLGISLCPGDGRDADELLKYADAALYQAKQQGRATYRFYTQALHDQSVERVQLERL
LRHALERHEFELYYQPQVDLRDGRIIGCEALIRWNHPGMGQVSPGRFIPIAEHSGLIIDI
GNWVMQEACRQPKRWHDQGRDIKVSFNVSARQFMRPAELMQSLKAALAESGVDATRMEVE
LTESLLLDPQGMGEVLHEIRALGIQLALDDFGTGYSSLSYLRRFPINILKIDQSFVSDAD
NNPDDAEMVKTIIGMAHNLRMSVVAEGIETEAHRALLAMQGCRVGQGYHYSRPVPAEEFS
RLLQRGSG
Download sequence
Identical sequences D9SEQ8
gi|302878206|ref|YP_003846770.1| WP_013292946.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]