SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302878223|ref|YP_003846787.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302878223|ref|YP_003846787.1|
Domain Number 1 Region: 485-731
Classification Level Classification E-value
Superfamily EAL domain-like 5.89e-87
Family EAL domain 0.0013
Further Details:      
 
Domain Number 2 Region: 307-470
Classification Level Classification E-value
Superfamily Nucleotide cyclase 4.91e-49
Family GGDEF domain 0.001
Further Details:      
 
Domain Number 3 Region: 15-166
Classification Level Classification E-value
Superfamily Globin-like 1.78e-32
Family Globins 0.004
Further Details:      
 
Domain Number 4 Region: 181-239
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000438
Family PYP-like 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302878223|ref|YP_003846787.1|
Sequence length 734
Comment PAS/PAC sensor-containing diguanylate cyclase/phosphodiesterase [Gallionella capsiferriformans ES-2]
Sequence
MNLSDEAVAALARAVRIDAQEIARRKEFLKFDETDVSLLTGLHARLQNVSRRFVEDFYAH
MLKFEETRRFIPDAPSLERLKRTQMSYFDSLTAGDYGSEYILHRLRVGVVHQHIGLEPKW
YLGAYSKYLAGLLPELWQQLGKEPEAFVATCQSLIKIVMLDMGLALDTYMQTDRDTILGL
KRYAEDIIASLPAGLIVVNDTLKVRSVNRSFREMFGLKNGEDVSGRELEDILPLLNLHQQ
AQVVLTSGIALRGIDAALGEKWLRLTITGIRLAEEEEEEDLLVIVEDITKLKAQAVHIEQ
LAFYDSLTGLPNRSLLRDRVQRVLAHSARHKNHGAILFIDLDNFKALNDTKGHNIGDLLL
IEVAKRLQDCVRNSDTVARMGGDEFVVVLEELNEDTQQAVAQAQDIGETVLASLNRPFNL
QGFEHYSSASIGISLFRDNEIGMDDVFKHADTAMYQAKTSGRNTLRFFDPDMQASLEARA
VLEIDLRHALSLQQFKLFFQIQMNAANQPIGAEALLRWLHPKRGLVSPLDFISLAEDTGL
ILPIGQWVLETACTQIKAWEANPLACELQLAVNVSARQFHQPDFVEQVRAALEKTGADPA
RLKLELTESVVLNNINDAVIKMSDLKEVGVRFSMDDFGTGYSSLSYLTQLPLDQLKIDLS
FVYNIGIKPTDAVIVQTIISMGNSLGMEVIAEGVETEAQRDFLERNGCHAYQGYLFSKPV
SIGEFEGLIRRMPI
Download sequence
Identical sequences D9SES6
gi|302878223|ref|YP_003846787.1| WP_013292963.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]