SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302878253|ref|YP_003846817.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302878253|ref|YP_003846817.1|
Domain Number 1 Region: 611-891
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 2.22e-72
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000000724
Further Details:      
 
Domain Number 2 Region: 19-115
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.43e-25
Family Flavin-binding PAS domain 0.015
Further Details:      
 
Domain Number 3 Region: 420-539
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000019
Family Heme-binding PAS domain 0.055
Further Details:      
 
Weak hits

Sequence:  gi|302878253|ref|YP_003846817.1|
Domain Number - Region: 368-415
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0235
Family HAMP domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302878253|ref|YP_003846817.1|
Sequence length 945
Comment methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor [Gallionella capsiferriformans ES-2]
Sequence
MRINTPVTNNEKQMMEGSMIVTKTDLKGIITYANKDFVEISGFAESELLGQSHNLVRHPD
MPVEAFADLWKTVKSGTSWNGIVKNRCKNGDYYWVDANVTPISENGQVTGYVSVRRKPAQ
EQINDAVKTYALLKAGKNPNAGINGLLQGLRHISVKQQIIMTIAVVAVLLGGISGLGYYE
LKMENEKFDYVVNHKVKSATQISRIDALMSENMRQLQLAGMHDPRLPESKLHDHPITKHL
DAIAVHSDEINAIWKDYNSTPHSTKGTELAEAFSKEQGAFVSEGIKPEIALLMEGKYADA
NVMMVKTLGPLFTIANGRATEIINHQNVSMEKDVVKSKEEFRITSNFMSFVFIIGMTLVV
IFGIMLFRNVVPRIRRVAEQIERAAHGESNQHVDSHPRRDEINAVFLAYRALATRMGFDV
AEAKRIADENLRIKIALDNVSTGCMIADNDRNIIYVNKAVVKMLNDAEADIRKQLPGFSV
ASLVGTNIDTFHKNPAHQAGMLARLQASYTTPVLIAGHSLVVTANPVITETGERLGVVAE
WIDRTIEVAVENEIENIIEAANQGDFTQRIILDGKEGFFLQVGQSINGLMQTSSVGLDEV
VRILNALSRGDLTESITNEYYGTFGQLKDDSNATVSQLTQLISRVIESADTIRTASKEIA
SGNTDLSQRTEEQASSLEETAASMEELTSTVKQNAENAKQANQLALSASDIAVKGGRVVG
QVVGTMSSISESSKKIVDIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVASEVRN
LAQRSAAAAKEIKELISDSVEKVGAGTRLVDEAGKTMDEVVNSVKRVTDIMAEITAASSE
QSQGIEQVNTAITQMDDVTQQNAALVEQAAAAESLEEQAQELAALMSTFKLSGQTKPIVL
SARAKVAAPVRRLPEPRPSAQKTTAASRSRPVKMPDTEDGDWQEF
Download sequence
Identical sequences D9SEV6
gi|302878253|ref|YP_003846817.1| WP_013292993.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]