SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302878337|ref|YP_003846901.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302878337|ref|YP_003846901.1|
Domain Number 1 Region: 298-396
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.06e-18
Family Histidine kinase 0.015
Further Details:      
 
Domain Number 2 Region: 54-170
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000742
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302878337|ref|YP_003846901.1|
Sequence length 401
Comment PAS/PAC sensor signal transduction histidine kinase [Gallionella capsiferriformans ES-2]
Sequence
MPANSLHIKQARKRNTSRAPSAHHEAAVTVARHKQDPLKTIEETPDHTPYSFLDSLPGMA
CQIRLDTQGALHLPYVSEGCLDLLGLSATELKQHPERLIKYLHADDAASFHQSMQHSARH
ATPWNWEGRTLLPPDGEIKWVNLRAKYRKTDLLGTHWKGLVVNITQNKQAEIELVHSRQQ
LRELSSHIENIKEEERTRIAREIHDEIGVLLTALKMDLAWMRQRFPSDDGALQEKSQVMA
NLLDTAGIAANNLVHSLRPGSLDCFGIVAAIEIEATEFTKRTATPCKIIKSSDNLDVSDE
QSITLFRVFQETLNNIMKHAQARRVQVKISQSATDQIDKYVELIVSDDGCGFDEAARNKP
RSFGLRGIQERIRQLDGTLSITSRPGKGTKIAVRLPKNGQR
Download sequence
Identical sequences D9SF40
WP_013293077.1.12990 gi|302878337|ref|YP_003846901.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]