SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302878352|ref|YP_003846916.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302878352|ref|YP_003846916.1|
Domain Number 1 Region: 252-487
Classification Level Classification E-value
Superfamily EAL domain-like 3.79e-55
Family EAL domain 0.0044
Further Details:      
 
Domain Number 2 Region: 85-208
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.73e-16
Family Flavin-binding PAS domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302878352|ref|YP_003846916.1|
Sequence length 491
Comment diguanylate phosphodiesterase [Gallionella capsiferriformans ES-2]
Sequence
MHHGIFRNVRAYLVAAALLGAALALVSAIFFTLDNLPWTAFLTGILVASVLAEAARASRS
EWVLMRRTAQLSSFKEKLEQESALRRSLEEKYAASLLRLRLMDEKISTMIVLIDTEGRCG
YHNRAFREWLHLKAESIEGRPIRELFGSHAYAGIATAVRQSLDGQSLHYEFFQEMPGGAL
YRLLVDHIPLFEADGKIAGFYFLAEDITQRGDVSGVTGAKKSSVAERDVDQQMYLDVFSE
QVSGRPDAGKQFIAAIQGGEFRLYCQLIAPLPVDSGRSAHYEILIRLLEEEGGMIPPGAF
FPLAEKNGLMPYLDRWVVEHVLSWISHQQNVDKEAIFFINVGAATIGDPDFSDFLQGALS
ETGMPGSVLCFEVAQTDLAIRNESVAEFARQVKLCGCRVALSGFGRDSVSFDQIRGFQVD
FIKIDGSLIFNLLSNPVDLAKVVSIDRVAKKIGVRTVAELVENDDLIEKLGEIGIDFAQG
FGVSRPRILGE
Download sequence
Identical sequences D9SF55
WP_013293092.1.12990 gi|302878352|ref|YP_003846916.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]