SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302878381|ref|YP_003846945.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302878381|ref|YP_003846945.1|
Domain Number 1 Region: 767-1011
Classification Level Classification E-value
Superfamily EAL domain-like 9.55e-89
Family EAL domain 0.0021
Further Details:      
 
Domain Number 2 Region: 589-751
Classification Level Classification E-value
Superfamily Nucleotide cyclase 9.42e-47
Family GGDEF domain 0.0001
Further Details:      
 
Domain Number 3 Region: 468-570
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.09e-26
Family Flavin-binding PAS domain 0.02
Further Details:      
 
Domain Number 4 Region: 315-450
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.65e-17
Family PYP-like 0.065
Further Details:      
 
Domain Number 5 Region: 200-310
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000006
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302878381|ref|YP_003846945.1|
Sequence length 1013
Comment PAS/PAC sensor-containing diguanylate cyclase/phosphodiesterase [Gallionella capsiferriformans ES-2]
Sequence
MHVKYDTSILKSEQTRNLFATHIPSLTASMLLAIILVYIQWDVVSHDVLVGWLILLEAVQ
LARMALVVRYQRNATVAEEVISARLMRFRFGVLVSGVIWGGASFLLFPQENLPHQMFLIF
MLAGLTTASVVSYSADLVSAVIFALSIVTPLIARLLIVSDELAMAMAIAVLLYLGFLMVS
LRLINRNLIENIRMRHEGELREAAMNVSKERYRLLLAHSPVGIFHYDLNFVITYCNARFA
ELIGCPVAQVNGLDLYNLSDNAVLPALTAALAGDRGYFEGQYQAVFNDGWIAMTCAASCD
ARGNVIGGIAIVESIHERKMAEMALALSNQKHDEERKLFQTILDNLPLGMWMLGVDGKIK
FVNETFCNALGIAAHDFFDAGHYSDLLPLSIADKCKESDRACFMQGEPHYSTEWLPFTDG
RAHLLEMTRVRLHDSANNVTGLIGLAADITERQKVESELRIAAAAFEAQEGMLITDRHNV
IMRVNQAFTSITGYLAEEVLGKNPCFLASGRHDAGFYQSMWEGLNEKGKWEGEVWNRRKD
GEIYPEYLLISAVKDIKNEVANYVATFRDITANKAAESEIKKLAFYDPLTLLPNRRLLTD
RLNHALASSARNRNIGALLFIDLDNFKTLNDTLGHDMGDALLKQVALRLKSCIREDDTLA
RLGGDEFVVILENLSELAMDAATKAELIGEKILAALNQVYPLASQEYHGAASIGVTLFAG
HALSIDELMKQADIAMYQSKKSGRNTLRFFDLDTQKIINERAELEIELRKAVDKKQLHLH
YQIQLNSVGTPLSAEALIRWVHPVRGLISPAHFIPLAEDTGLILPIGQWVLDTACAQLHS
WQDERFTQDLTLAVNVSAKQFHQKNFVALVKETVQRHAINPKLLKLELTESMLVENIEDI
IVTMNALREMGIQFSLDDFGTGYSSLQYLKRLPLNQLKIDQSFVRELSSSSSDRAIVRTI
VAMAESLNLNVIAEGVETEEQHTLLQDIGCNYYQGYLFGKPMPIEQLDAILAR
Download sequence
Identical sequences D9SF84
gi|302878381|ref|YP_003846945.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]