SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302878534|ref|YP_003847098.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302878534|ref|YP_003847098.1|
Domain Number 1 Region: 564-735
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.18e-44
Family Histidine kinase 0.0013
Further Details:      
 
Domain Number 2 Region: 762-887
Classification Level Classification E-value
Superfamily CheY-like 4.7e-36
Family CheY-related 0.0039
Further Details:      
 
Domain Number 3 Region: 340-469
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.93e-23
Family Flavin-binding PAS domain 0.058
Further Details:      
 
Domain Number 4 Region: 495-575
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 2.75e-20
Family Homodimeric domain of signal transducing histidine kinase 0.002
Further Details:      
 
Domain Number 5 Region: 219-341
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.44e-16
Family Flavin-binding PAS domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302878534|ref|YP_003847098.1|
Sequence length 963
Comment multi-sensor hybrid histidine kinase [Gallionella capsiferriformans ES-2]
Sequence
MKNDNPVVNEKSLYRELTISLALLVSLVSIAVSLLNYAYSSREADVMLASKISAYTDNLR
ESLEWPLWNVDDELISKIGRAFVANAEIAELTIRDDQQRVIYQHRHRDGRLILREFSVEH
EGKYIGSVEISLSLRAFEEKNHWLLLTSLGTAALLIISLLGAMRWMLARLLKKPVDNLVG
AIAQVVEGRYPLIALAQTYTEFAPIISGFKTMSDAVASREASLRASEQKMLSILEGVDAY
IYLKDTEGHYLFANRPLRELWQVEMNDLIGFGDEKFFNAESVVTLRQTDSRVLRGGETLH
SEEVNTIAATGKTVYYQSTKLPLYREDGSIYALCGISVDITERKRIEEALRVNEERLKLA
TRAGGIGIWDWDVAANVLTWDDSMYLLYGLCAGDFGGAYDAWLSTLHPDDRALSDAEIQA
ALRGEREFSPEFRVIRPDGEIRKIKAFAKVYRDESGSPTRMVGTNFDITDLKRIEEELRK
YKDHLEEEVQSRTSELVLARNAAETANLAKSVFLANMSHELRTPLNAVLGFSSLLRKDPL
LSKEQRTNLNIINRSGEYLLALINDVLEMAKIEAGWVQLDSAPLDLGMLVRDVTDMMQVR
AQEKGLQLLIDQSSEFPRYIRGDEARLRQILINLVGNAVKFTQQGGVTVRFGLKPNTTPA
HLLIEVEDTGSGIAAEDQEKIFEPFVQVGEVAMQKGTGLGLTITRQFVQLMGGSVTLNSK
PGSGSLFRVELPINMVRAQDMIEAKSTLQGEIIGIKPGQPAYRILIVEDQQENQLLLRQL
MERLGLPVKVASDGVEALELFNSWHPDLIWMDRRMPVMDGIEAARRIRALPGGEATKIIA
VTASAFMEQRTEMLAAGMNDFVRKPYRFNEIYDALSMQLGLQYVYADTPDASVSEVVLTD
EMLMGLPEMLRSELNDALESLEVDRINHAILQVPDEALRETLTALVANFDYPVILKLLQA
SAV
Download sequence
Identical sequences D9SFN7
gi|302878534|ref|YP_003847098.1| WP_013293273.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]