SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302878536|ref|YP_003847100.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302878536|ref|YP_003847100.1|
Domain Number 1 Region: 469-641
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.37e-45
Family Histidine kinase 0.0012
Further Details:      
 
Domain Number 2 Region: 667-792
Classification Level Classification E-value
Superfamily CheY-like 5.12e-34
Family CheY-related 0.0031
Further Details:      
 
Domain Number 3 Region: 264-379
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.99e-24
Family Flavin-binding PAS domain 0.094
Further Details:      
 
Domain Number 4 Region: 401-481
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.61e-21
Family Homodimeric domain of signal transducing histidine kinase 0.0016
Further Details:      
 
Domain Number 5 Region: 50-170
Classification Level Classification E-value
Superfamily Sensory domain-like 0.000000000589
Family Sensory domain of two-component sensor kinase 0.029
Further Details:      
 
Weak hits

Sequence:  gi|302878536|ref|YP_003847100.1|
Domain Number - Region: 202-245
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00824
Family HAMP domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302878536|ref|YP_003847100.1|
Sequence length 872
Comment multi-sensor hybrid histidine kinase [Gallionella capsiferriformans ES-2]
Sequence
MNLFMTFIHKLQHEWGRSIRRQLIWSFSLASLLVSLSFGYLLYAYQRNFQYDLGTQSALE
LAQALSSSSSSWVLSNDLAGLQEVLSGAAQVTDIKFAAVISPDGEVQASTRSEYINRHFS
DPVSQRMLGKVVQTKILKNNQELIDVAVPVLAGTRLIGWVRVEMSRDRANANLSKIAAAG
FAITLLLVLMIVLIATWLADRFTRGLQRLSAVADNAEHGRSFARDDSERQDELGILARHI
YKMLDAKAEEEKGRLDSEARYSVVFNNAAVGLAQIAISGQFIQINQEFCKIIGYTQEEIL
SQNFTFERITHPDDIAVDHEYIRQLLAGDRQSYMLEKRYIRRDGGLVWVNLSVYLQRDSR
GDPLYLISAVLDLSERKQAENELKRYKDHLEEEVQQRTADLVLARDAAEAANRAKSVFLS
SMSHELRTPLNAILGFSALMSRDTMLSHIQRENLNIINRSGEHLLSLINDVLEMAKIEAG
RVQVLHEAFDLGALVRDVSDMMAVRAQEKGLQLLVDQSSDFPRYIMGDEARLRQVLINLV
GNAVKFTQHGGITMRFGIKPNLLPERLLIEVEDSGIGIKPEDQQRIFDAFVQIGDLSAQK
GTGLGLTITRQFVQLMGGVITLESTPGVGAVFSVELPIEKVSPAEVAKTKKIVQGEIIGL
LEGQPVYRILIVEDQLENQLLMSRLMEQLGFEVRVAENGRLGVEIFSRWHPDLIWMDRRM
PVMDGIEATRLIRGLPGGREVKIVAVTASAFMEQRAEMLDSGMDEFVRKPYRFNEIYECL
SRMLGVQYRYASTVVDEESATGAVLTDNMLASLPDELRRVLQEALESLEIDRVDAAIGQV
HDAKLKTTLRQLAENFDYPAILKALRSDTMEK
Download sequence
Identical sequences D9SFN9
WP_013293275.1.12990 gi|302878536|ref|YP_003847100.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]