SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302878539|ref|YP_003847103.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302878539|ref|YP_003847103.1|
Domain Number 1 Region: 675-920
Classification Level Classification E-value
Superfamily EAL domain-like 3.79e-89
Family EAL domain 0.0039
Further Details:      
 
Domain Number 2 Region: 495-662
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.49e-44
Family GGDEF domain 0.00016
Further Details:      
 
Domain Number 3 Region: 21-265
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.42e-18
Family Phosphate binding protein-like 0.07
Further Details:      
 
Domain Number 4 Region: 365-477
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000533
Family Heme-binding PAS domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302878539|ref|YP_003847103.1|
Sequence length 927
Comment PAS/PAC sensor-containing diguanylate cyclase/phosphodiesterase [Gallionella capsiferriformans ES-2]
Sequence
MIRIFITALLLVIAHGAYANNQEMRIGVLSFRPLEQTRMQWQPTADFLNNHVPGFHFSIK
ALYYNDLDLAANRHEFDFIVTNPEHYVSVRRDHGLSAIATLMPMVEGHPITMFGGVILTR
ADRSDINTLQDLRGKIIASPAEQSLGGYLMQRWTLYKQGIGIREVSRVHFTGMPHDKALL
EVTSGAADAAFVRTGILESMEREGKIRPDQFKVLNRQPSGKFPQLLSTDLYPEWPFAAMP
DVPDVLLKQVTLALLNIQPQDIAAQRGNYFGFSPPGNYATVEAMMQRLAVNPELAHEFSL
RDVARKYVLELVGGGLLVLLILLAAAIYLARNNRRLQSSYRERERLDHQLQSANATLEEK
VATRTRELQISEARFRQMFEHHASPMMLIDPLGGAVVDVNQAAAEFYGYRIAEMQAMNIA
QINLQTEEDCRPQQTKGNCFFFSHQLASGEVRLVEVHSSPVEVDSRPLLFFIVHDITERR
HLEEKMHDLAFYDLLTKLPNRRLLLDRLEKALLSGTRSRHHSALMFLDLDHFKVLNDLHG
HDIGDQLLVEVANRILGCIREQDSAARFGGDEFVVMIEDLSENLSDAVNQADSVAEKIRC
ALAAPYLLKRGEEVISHHCSSSIGVTLFRDHEENLEQLLKWTDMAMYHAKDAGRNVIRFF
DPVMQTAIENRAALENDLHTALEERQFELFYQIQVDRDGRAEGAEVLLRWRHPQRGLVSP
AQFIPLAEDTGLIVPIGEWVLDTVCAQIAKWQGEQRNLVIAVNVSAKQFRQSNFVELVQQ
IIQRHQVSPALLKLELTESLVLDNIQDTIDKMKVLKAFGVSFSMDDFGTGYSSLSYLKQL
PLDQIKIDQSFVRDIATDKTDLVMVKTIVDLGVNFEMDVIAEGVESEVQLGLLKQCGCSR
FQGYLFSKPVPVEAFELLIKGDTVGQA
Download sequence
Identical sequences D9SFP2
gi|302878539|ref|YP_003847103.1| WP_013293278.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]