SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302878540|ref|YP_003847104.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302878540|ref|YP_003847104.1|
Domain Number 1 Region: 440-721
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 8.89e-72
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000000856
Further Details:      
 
Domain Number 2 Region: 247-374
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000272
Family PYP-like 0.08
Further Details:      
 
Domain Number 3 Region: 198-247
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000732
Family HAMP domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302878540|ref|YP_003847104.1|
Sequence length 864
Comment methyl-accepting chemotaxis sensory transducer with Cache sensor [Gallionella capsiferriformans ES-2]
Sequence
MNGLAILALLLVAMVALLSERNTLTDDRQRATRYAVETAWGMVETLGKSAASGEISIEQA
QSRAIAQLKAMRYDGKEYFWVNDMQPRMVMHPTKPELDGKDLSASKDPNGKFLFLDMISV
VKKDGAGFVNYEWPRPGSEKPVPKISYVKGYQPWNWVIGSGVYVDDIDAAVTTHAWQLAL
IVFLIGGAMTAASSLMARNITRRISIAAALANEVSHGRYDNSIIADGKDEITDLLRSLST
MQIKLLERFEAEQRSAHEMSRLKCALDNVSMCVRVADNDGKVIYINNALNDTLHRYEEAF
QQENSSFIADKVLGGSIGVFYADPQAAIERLRNLRSTVHTRLKLGGRQYDVVTTPVVSSD
GERLGTVGQWLDLTDQIKAEVEVSAIVEAAAKGDFSGRITVEGKVGFFLQLAESINGLMQ
TSEVGLNEVVRVLGALAQYDLNETIDGDYQGTFAQLKDDSNATVGQLTEIISRIKEAAET
INVAAGEIAVGNTDLSQRTEEQASSLQETASSMEELTSTVRQNAANARQANQLAVGASAI
AVRGGEVVGQVVHTMSSISESSKRIVDIISVIDGIAFQTNILALNAAVEAARAGEQGRGF
AVVATEVRNLAKRSAVAAKEIKDLIGDSVHKVQAGTELVDQAGKTMEEVQGAVKRVTDIM
AEISAASAEQSTGIDQVNLAITQMDNMTQQNAALVEQAAAAAESMEEQAEQLTVMMATFK
LGNPKKSLVTSAPRLVSPSAFSFGDGINAHIKWKTRLVDYIKGNSQEELEVAKVSCDDKC
DLGKWLYGPATSYAQMQEYRDLKHSHAEFHRSVGVIVQCVHDKQLDEATKKLGGEFFQLS
NQTIRSIKALQARVTGTNAPKLLK
Download sequence
Identical sequences D9SFP3
WP_013293279.1.12990 gi|302878540|ref|YP_003847104.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]