SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302878541|ref|YP_003847105.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302878541|ref|YP_003847105.1|
Domain Number 1 Region: 671-842
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.16e-43
Family Histidine kinase 0.0022
Further Details:      
 
Domain Number 2 Region: 869-987
Classification Level Classification E-value
Superfamily CheY-like 9.68e-34
Family CheY-related 0.0049
Further Details:      
 
Domain Number 3 Region: 603-683
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 3.92e-21
Family Homodimeric domain of signal transducing histidine kinase 0.00076
Further Details:      
 
Domain Number 4 Region: 472-595
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.66e-20
Family Heme-binding PAS domain 0.058
Further Details:      
 
Domain Number 5 Region: 346-473
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.26e-19
Family Heme-binding PAS domain 0.049
Further Details:      
 
Domain Number 6 Region: 1012-1109
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 0.00000000000119
Family Phosphorelay protein luxU 0.026
Further Details:      
 
Domain Number 7 Region: 110-208
Classification Level Classification E-value
Superfamily Sensory domain-like 0.00000000451
Family Sensory domain of two-component sensor kinase 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302878541|ref|YP_003847105.1|
Sequence length 1115
Comment multi-sensor hybrid histidine kinase [Gallionella capsiferriformans ES-2]
Sequence
MLEKVQRNLVLWVIVLLLCWVMLAWVMAARNFDGELFELVEREQHSAETTSTDVADSIKR
SLHFVAGIPDTFQNAMRARKALGEFPPDVQPTTLSKTDAVKKWTANPVLEDINKYFELTQ
RSLGVDLVFLVNAAGDCISASNWGQPGVSIGTNFSDRQWFQDAKTWFRGMQYAVGKTTHV
PGLYFSTPIVLDGKFQGAVVAKIDLPTLGFLTQRADAYIVDSNGVIIMAHDPEMVMLTIP
DATVNKLSRQDKQQLYQRTEFASLKIESWKGSDRLKRINGENFPHVLAATSLPEYGMTVY
AESDLPGIAVLERDRRNMFFLISLLGCTLILIGGGLIYYFRSVRDAKHTVEESESRLRLL
LESVNGGIWGQSLNGGICTFINAAGAKMLGYQPDELLGQSLHSLVHHTYPDGAHYEAEIC
PMHATSLDGIPRKINNEVLWRRDGTSIAVEYSTHPMYRDGRIEGTVVVFEDITERQRMER
QMQERDAVYSAAIKTSVDGFWTVDLEGYLLEVNDAYVQASGYTRDELLSMRVSQLEVIDS
EADVETRIEKIRREGSDEFESRHRTKAGRIWDVSVAVSYAPIAGGRLFCFVKDITERKQQ
AKLLEAAREKAESANRAKSDFLANMSHEIRTPMNAVIGFSELALDDPNPVSQRAHLQQII
ESSRSLLGILNDILDFSKIESRQMTLEMEVLNLDELLGQVRRMFVMQAKERTLDLVVARE
AGVPNILTGDPLRLRQILTNLLGNAIKFTNQGAVSLNVRAIQTNSENVTLDFCVKDSGIG
MSAAQLASLFQPFVQADNSITRRFGGTGLGLTISRNLARLMDGDIRVDSVAGTGSEFHFE
VTLPIANAMQLASHVKDVPPVQDMTQALYGKRALLVEDNKVNQLLATHVIKKLGMLLDIA
NHGVEAIECVEHQQYDVVLMDIQMPVMDGLEATRLIRQDSRFASLPIVAMSAGVTLDEQE
KCSEVGMTDFIGKPIDSELLTQMLIKLCVDVDKESLRPDSPVLSNSGVLHIEGFDDERLA
EVVALLGDHDLLFELIASMRLEFAEIVEQVTRLIDSNQMEEAKSKLHALKGVAGNLGADR
ICAVIATLEAKLNAGQSPSEALEDFVQVWNLFMNT
Download sequence
Identical sequences D9SFP4
WP_013293280.1.12990 gi|302878541|ref|YP_003847105.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]