SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302878602|ref|YP_003847166.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302878602|ref|YP_003847166.1|
Domain Number 1 Region: 333-459
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.27e-27
Family Heme-binding PAS domain 0.046
Further Details:      
 
Domain Number 2 Region: 70-199
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.01e-20
Family Flavin-binding PAS domain 0.077
Further Details:      
 
Domain Number 3 Region: 208-334
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.77e-19
Family Heme-binding PAS domain 0.058
Further Details:      
 
Domain Number 4 Region: 692-816
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.67e-16
Family Histidine kinase 0.054
Further Details:      
 
Domain Number 5 Region: 458-590
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000089
Family Heme-binding PAS domain 0.06
Further Details:      
 
Domain Number 6 Region: 4-81
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000122
Family Heme-binding PAS domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302878602|ref|YP_003847166.1|
Sequence length 827
Comment PAS/PAC sensor signal transduction histidine kinase [Gallionella capsiferriformans ES-2]
Sequence
MALDYWALTPERYAVQEACQLESLQSTGRYGPYEKEYIREDGSLIPIRLNGMLMTGADGQ
QYIWSIVEDISAQIEAAAALRMSEARFHEMAQAVDEVFWMMPPDGKSIQYISPAFESIWG
VRCEQLYAQPELCTQMAHPDDRERVGRAIANLALGVNFDIEYRIIRPDGELRWISDRGYA
IRDASGQVINTTGVSSDITQKKLIESNLKIANEKFRSSAQMLEAIVEHIPVMVFVKRASD
LTFELFNRAGEALLGYERSALLGLGDRDFWPHDQADGFIEADREVLASNQVKEIAKEQIT
VAGGEIRYLHTWKIALRDECGQATHLLGISMDITERERAEKRLRESEEKMRAIVDGALDG
IVLLDPETLQFASANPAFCTMTGYTRQEIDRLNVHDIHPAEGFSRVAEQLALHIQGEQFL
STDIPVKRSDGSIFFVDIKSARVMLSGKRYLVGIFRDITQRRLADAQLKMSARRYQLLFD
HSRDALMTLSVPAYQFTSANAQTLTLFAADRLADFIALRPWDVSPECQPDGTLSSEKALD
NIQQALESGLCSFEWQHRRLDGTLFSADVLLTRMKLGDELFLQATVRDITLARLRELELK
EFQQLLRDLAAQGVASREAELKHIAREVHDELGQLLTALRMDISLLRIQFANHIPLLMPK
IKDMLTLVDKAIQGARDVTRNLHPPALDMGIVPATIWLQDELTSRSNIKCTLHVIKEPPV
IEDALTLTLFRILQESTTNIMRHANASCMEITIDCNHEFIFLRVSDNGTGFDETLLPSKK
SFGLMGMKERALAVSGKVEINSQPGLGTVVSVHIPLFKTHTRRREND
Download sequence
Identical sequences D9SFV5
gi|302878602|ref|YP_003847166.1| WP_013293341.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]