SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302878603|ref|YP_003847167.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302878603|ref|YP_003847167.1|
Domain Number 1 Region: 44-152
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000663
Family N-terminal PAS domain of Pas kinase 0.065
Further Details:      
 
Domain Number 2 Region: 163-202
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000628
Family PYP-like 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302878603|ref|YP_003847167.1|
Sequence length 202
Comment PAS sensor protein [Gallionella capsiferriformans ES-2]
Sequence
MSGQDLRDKAEAQLKGIKSDQPLDSLLHELQVYQIELEMQNETLRQNQIQLEESRDRYLD
LYDFAPVAYLTVNAVGMIIEINHTGALLLGMERKKILRRRLSQFVTAEDNERWCRCFLKM
MNHDSACHDEFSFKRLNGTTFYAGVDSRFIHGVEKTVRITLTDVTERRLAEQMLRVKEQK
LHGLFELCPLGIALTDMTGRYI
Download sequence
Identical sequences D9SFV6
WP_013293342.1.12990 gi|302878603|ref|YP_003847167.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]