SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302878845|ref|YP_003847409.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302878845|ref|YP_003847409.1|
Domain Number 1 Region: 394-552
Classification Level Classification E-value
Superfamily Nucleotide cyclase 7.85e-55
Family GGDEF domain 0.00041
Further Details:      
 
Domain Number 2 Region: 269-376
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.41e-29
Family Flavin-binding PAS domain 0.066
Further Details:      
 
Domain Number 3 Region: 6-144
Classification Level Classification E-value
Superfamily CheY-like 1.27e-27
Family CheY-related 0.001
Further Details:      
 
Domain Number 4 Region: 126-253
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.79e-19
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302878845|ref|YP_003847409.1|
Sequence length 560
Comment response regulator receiver modulated diguanylate cyclase with PAS/PAC sensor [Gallionella capsiferriformans ES-2]
Sequence
MMNNAPCRILLVEDEESDASLLRQSMKSAPTFTIDWVTSMAEAQLYLQKNVPDVVLLDLT
LPDSSGLQTVQDGRRAAGALPLIVLTGHNDPEFALQTLESGAQDYLVKGEFCADDLIRSI
RYAMSRAKLEQRLIEAEERWRFALEGAGDGVWDWNVQTNEVKFSVRLKEMLGYADDEIAD
HLDEWMRRIHPEDLPKVQADVAAYFAGALPAYFNEHRLLCKDGRWKWILDRGRVVSFDAA
GEPLRMIGTHTDIDMLKQAEEMLNLSSTVFNTVDEAILVCDADNRIVMVNPAFTRVTGYQ
AEEVIGKNPHLLSSGKHDADFYRQLWAQLTCTGSWCGELWNRRKNGELYVEWSTIKQVRD
PHGKLTHYVAAFSDITLRKADEENIRHQAQHDALTDLPNRVLLIDRLRQALSLAKRDKMH
LALMYLDLDQFKPVNDTLGHAVGDLLLQEVAARIRSCVREADTVARMGGDEFVVLLTSSE
DQRDALTVAEKIRIALEQVFQISGARLQISSSLGVAVYPEHGASEHELLEHADIAMYYAK
QSGRNQVRLYEPEMMPVQDK
Download sequence
Identical sequences D9SGJ8
gi|302878845|ref|YP_003847409.1| WP_013293584.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]