SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302878846|ref|YP_003847410.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302878846|ref|YP_003847410.1|
Domain Number 1 Region: 486-625
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.29e-30
Family Histidine kinase 0.0048
Further Details:      
 
Domain Number 2 Region: 276-384
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.5e-19
Family Heme-binding PAS domain 0.034
Further Details:      
 
Domain Number 3 Region: 169-262
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000349
Family Heme-binding PAS domain 0.07
Further Details:      
 
Domain Number 4 Region: 395-472
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000726
Family Homodimeric domain of signal transducing histidine kinase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302878846|ref|YP_003847410.1|
Sequence length 630
Comment multi-sensor signal transduction histidine kinase [Gallionella capsiferriformans ES-2]
Sequence
MIDNLTPAVSIAHGSWISWQPELATVLIIGNLLIALSCFAAPLMVLKFIRDRTDIDFKYL
HWLFAGFIVTCGFTHLLHVIELWYPVYYLEVLMDMLTAFVIMLALILLWKLKPLVMTLPS
RAQLRAASEALKKLTDDIKDREIQLLNLGNSLPDSFLYQYTLNEGFPVFLFLSSGVERTN
GVKVDQVLQDAMVLLAQIAPAQRETYAAAQAVSLQCLNNFSMELQMQRPDGEWRWLQFKS
HPRKNNEGLVVWDGIATDITDRHLFEMEINRLAQAIEQNPTGVVITDTNGVLEYMNAACS
RISGYQFADFYIEHRTPREIISSELTEAEYGDVQSQLMAGKLWSGVIRNRHKSGRLYWEQ
INVSPIYNNEGKVASYLYLRSDVTEQINADTDLKLRSAELERANADLTRFSDVSAHHFME
PTRRLISYAQKLRTRVNEMPDTCQDHEVMESLNYIERDAFRLRTLIRDVQLFLAAGMPRG
EIQLEDPNELLASHLHKMPPNMKVEMTTLPQVMLDRARLNDLFGVLLDNALKHGQPADPD
VLPVICISGEREGALSRFRISDNGCGIPSEYLERVFEIFERLSHGSDGGAGIGLSIARRI
VESRHGKIWIENLPAGGAMVVFELPDGVAS
Download sequence
Identical sequences D9SGJ9
WP_013293585.1.12990 gi|302878846|ref|YP_003847410.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]