SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302878851|ref|YP_003847415.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302878851|ref|YP_003847415.1|
Domain Number 1 Region: 775-939
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.57e-34
Family Histidine kinase 0.0017
Further Details:      
 
Domain Number 2 Region: 447-577
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.44e-27
Family Flavin-binding PAS domain 0.025
Further Details:      
 
Domain Number 3 Region: 576-701
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.98e-21
Family Heme-binding PAS domain 0.028
Further Details:      
 
Domain Number 4 Region: 320-448
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.05e-17
Family PYP-like 0.088
Further Details:      
 
Domain Number 5 Region: 704-782
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000000235
Family Homodimeric domain of signal transducing histidine kinase 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302878851|ref|YP_003847415.1|
Sequence length 942
Comment multi-sensor signal transduction histidine kinase [Gallionella capsiferriformans ES-2]
Sequence
MLKDTVAPSRFFLQMVAGAVLVNLAMFFLVGLILYQSYHQYQHNAEKMTQSLAHILEESF
SGMLARVDASMLSAIDEVQRQYKSGKINPAELNVFLQKRQVRLPEIDNLRIANSAGIISY
GTGVLPGSNVDINDRKHFIYFKSKNDDRLFISEPVFARIDKKWVLPIARRLNHPDGTFAG
IVYALVSLEKISTSFSHLEVGKGGIVNLRDSDMNIIVRYPEPSSAQATIGKNTMTPQLKS
SLEAGLTKGTYRVAGILDQVERTYSYRKVSGYPLYITVGFSADDYLAQWRNSSLKLVGLS
AVFLVISVLLLGMLYRGERRRREAVDALQILNRDFMTLLESTTDFIYFKDRDSRIRFCSQ
TLANITGHQNWREMIGKHDLEIFPEDVAKIYYEEELPLFNSGSPILNRIDPYYDSAGRQG
WVSTNKWPVFAEDGKTVTGIFGISRDISDFKRAEISLRLSEARYRATFDHAAVGIAQVST
DGVFLEINRVFCNIIGYTQSEVLSQHFSFGQITYPEDLASDMAQVQRLLSGADDHYEMEK
RYIRKDGGIVWVNLSVALLRDTEGLALYFISSVVDITQRKQAEAQLLESEAHLRAIINNE
PACIKIVDDQGILIQMNPAGLEMIEADSLAQVAGRPVTGVIAPEYREAFLQMHKRVIAGE
SMQLKFEVLGLKGGRRMLETHAVPMEAYGKRVQLAVTRDITERQRIEDALKRSNADLERF
AYSVSHDMRQPLRAVSGHLQLLQHSLKEQLSEDDLLNMNFALDGAKRMDSMIVSLLDYSR
VGRKTGEKQGIESRAVLDEALSFLQPMIQESAAQVTFQGVWPQLFASRDELTRLFQNLIG
NAIKFHESGQAPLIEIKSVVAKAMWRVSVKDHGVGIDPKQADRLFQFFSRLQSRTIFEGT
GMGLALCRRIVEHHDGRIWVESAGVGSGSTFIFELPVITHDH
Download sequence
Identical sequences D9SGK4
WP_013293590.1.12990 gi|302878851|ref|YP_003847415.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]