SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302878852|ref|YP_003847416.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302878852|ref|YP_003847416.1|
Domain Number 1 Region: 581-826
Classification Level Classification E-value
Superfamily EAL domain-like 2.22e-82
Family EAL domain 0.0012
Further Details:      
 
Domain Number 2 Region: 403-566
Classification Level Classification E-value
Superfamily Nucleotide cyclase 2.82e-40
Family GGDEF domain 0.00026
Further Details:      
 
Domain Number 3 Region: 12-149
Classification Level Classification E-value
Superfamily CheY-like 6.97e-28
Family CheY-related 0.0011
Further Details:      
 
Domain Number 4 Region: 278-385
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.59e-26
Family Heme-binding PAS domain 0.041
Further Details:      
 
Domain Number 5 Region: 157-267
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000209
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302878852|ref|YP_003847416.1|
Sequence length 832
Comment response regulator receiver modulated diguanylate cyclase/phosphodiesterase with PAS/PAC sensor(s) [Gallionella capsiferriformans ES-2]
Sequence
MLRVRVFKLNTQYSVLLVEDEPADAHLAQQALRASRSPVFSVVWVTTLALSLLELKQQRF
DVLLLDLSLPDSNGIETVHRIREVASEMPLVVLTGHDDTSFALQTLEAGAQDYLVKGKFD
TDALVRSIRYAIERKLLSVNLQKSHDLLHKLSDHVPGLIFQFRLDVDGHMSFPFASRAML
ELYGVEADAVRDDATAVFAFQHPDDTAGIAASIQESARTLTPWHHEYRILLPEQGVCWRR
GDARPEKQVDGSILWHGFITDITENKKIEARLELASRVFETTGEAIVVTDVSGAIIAVNP
AFCRITGYSEAEVVGKNPRMYKSGLHKQAFYRDFWSELIKHGQWCGEIWNRRKNGELYAQ
WESVTTIKDSKGNTSSYVAVFSDMSEIKKAQAEVEELSWRDPLTGLANRALFLRQVEQAL
VSSKRDDYFAAVLLIDLDRFKEINEARGLAIGDALLRSVADRLGQTLHRDDLLARLDSDE
FAVLLPRLHIPREKAGREALAVAEKLRAALRCAIEMDGEFIHVDASIGIAMLPDTPQETA
IDVLRQADMAMTNAKAEGRSRTMFFESLMGETVRARFQLEAELRLAILEDQLRLYLQPQV
NSSGVQVGAEALVRWQHPTRGLTLPGLFIPLAESSDLIISIDRWMLSAVCRLLAELDAEG
SSIRLSVNISPRHFQQADFVSEIQHQLEASGADPSRLVLELTEGIVIGDIGDVIAKMTLL
STLGIHFSIDDFGTGYSSLAYIKRLPIHELKIDKSFIQDCTSDPNDAALVETILSIAKHL
HFQVVAEGVETLGQSEFLNARGQIIHQGYLYGRPEPAAVWRARLSQSGATDL
Download sequence
Identical sequences D9SGK5
gi|302878852|ref|YP_003847416.1| WP_013293591.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]