SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302879091|ref|YP_003847655.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302879091|ref|YP_003847655.1|
Domain Number 1 Region: 657-904
Classification Level Classification E-value
Superfamily EAL domain-like 1.28e-88
Family EAL domain 0.0014
Further Details:      
 
Domain Number 2 Region: 486-643
Classification Level Classification E-value
Superfamily Nucleotide cyclase 7.85e-52
Family GGDEF domain 0.00011
Further Details:      
 
Domain Number 3 Region: 222-344
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.08e-20
Family Heme-binding PAS domain 0.016
Further Details:      
 
Domain Number 4 Region: 343-468
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.44e-16
Family N-terminal PAS domain of Pas kinase 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302879091|ref|YP_003847655.1|
Sequence length 907
Comment PAS/PAC sensor-containing diguanylate cyclase/phosphodiesterase [Gallionella capsiferriformans ES-2]
Sequence
MDRRSGQVGRIRRLMWGVVGSVLLTVSLGGYWFVEVVTQLGQQAREDRIQLLALENSVSD
VMAELADQTQEWKDILLRGYDPVLRAKHQNAFEAHASSLQNKLLNVQAAARKLAIDVGEM
ENFVRQHQELMANYHEALALFDPKDVYSARLVDGRVQGRDRLLRDALHREVKKLEGQIVA
REQGMVAGVLGRHGLKLGALAMVLPLLSLWFFWQVYRALGFIVQSDARIRAIYEAIGDAV
LVGDRQGRVESINATAQRLLGWTEAEARGKLISDVFELYDVHHQQRVESPAESVLRDGIP
IPMSNGMLLRRRDGSQLAVEDSAAPVRDEHGNAVGVVMVFHDVSKRYALLDELGAARAQF
ETLFEQLPEGVLLFDESLAVITHNREAANLLEYASDALLLLQVSDIEAMDDQNAIAARKE
KLQLTGIDNFESRYRTRSGRLMDVDVSVQVVQLPNGRIAFQTLFRDITEQKQTSAQIEHL
AYHDQLTGLPNRRLLKDRLSQAVSSVVRRDAKLALMYLDLDHFKDVNDSLGHGAGDVLLQ
IVAERLQGCVRADDTLARMGGDEFVLLLNGVNGADDVASIAGKIIHELSQPMRIGNDELR
ITPSLGISMCPQDGRDADDLLKYADVALYQAKQQGRATYRFYTQALHDQSVERVQLERLL
RHALERNEFELYYQPQVDLCDGRIIGCEALIRWNHPGMGQVSPARFIPIAEQSGLIIDIG
NWVMKQACHQAKRWHDQGWDIKVSFNVSARQFMRSGELMQSLRDALAESGVDPTRMEVEL
TESLLLDPQGMGEILHEIRALGIQLALDDFGTGYSSLSYLRRFPISILKIDRSFVSAADN
NADDAEMVKTIIGMAHNLRMSLIAEGIETNAQRDMLETQGCEVGQGYHYSCPVPATEFSL
LLQQGIR
Download sequence
Identical sequences D9SH94
WP_013293825.1.12990 gi|302879091|ref|YP_003847655.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]