SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302879092|ref|YP_003847656.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302879092|ref|YP_003847656.1|
Domain Number 1 Region: 253-382
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.63e-21
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.051
Further Details:      
 
Domain Number 2 Region: 145-257
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.09e-17
Family Flavin-binding PAS domain 0.074
Further Details:      
 
Domain Number 3 Region: 424-489
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 2.18e-17
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0048
Further Details:      
 
Weak hits

Sequence:  gi|302879092|ref|YP_003847656.1|
Domain Number - Region: 35-106
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00344
Family BphP N-terminal domain-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302879092|ref|YP_003847656.1|
Sequence length 491
Comment transcriptional regulator, LuxR family [Gallionella capsiferriformans ES-2]
Sequence
MTQSPPSFGNIAPDKIRCAEYDGLGAEFHILLSDSPVVLSVSGSIEALLGFTPDDFIAGH
ISLPDRIHLEDGDLASLLFLNADSPASGSFPIRLRQANGQIRIVRLDFEKSSADKSGVRL
RLILKDAKGLYDIDTAPVDLHFKYMMDSTDDFICFKNKNHVITGASQALASICPRGQRWG
DLIGQTDYELFPEEFADRCYQLEKLIYAGMPSVNVELEYVQVNGECGWVNSRKYPIHGDQ
GEIVGVFGVSRDITERKIFEEALKKSEARLTLAQRMSHLGNWELDLISNVLWWSEEIFRI
FEVDSNSFTPSYEAFLAVVHPDDRGTVSSAYLNSLKSKIPYDIEHRLLLTDGRIKYVHER
CETVYDSGGNPLRSVGTVQDISDRKRLKLEGTDMLRRIESLILQMDDRTVAATPEENAIV
RSEEGAGKLSRRHLDVIGLIAAGLTSAQIAARLNISQTTVITHRRNLMRKLGLHSAAELT
AYAIKNKIVAC
Download sequence
Identical sequences D9SH95
WP_013293826.1.12990 gi|302879092|ref|YP_003847656.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]