SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302879112|ref|YP_003847676.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302879112|ref|YP_003847676.1|
Domain Number 1 Region: 2-315
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.46e-50
Family UbiE/COQ5-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302879112|ref|YP_003847676.1|
Sequence length 346
Comment type 11 methyltransferase [Gallionella capsiferriformans ES-2]
Sequence
MHEAVQDYYGKQLQTSDDLKTSACCDASALPAWLKPLLAKVHPEVLSRYYGCGLVCPPRL
EGCRVLDLGSGSGRDVYALAQLVGKTGEVVGVDMTPEQLAVAEKYRAHHAEQFGYANVRF
LEGYIEKLDELGLEPGSFDVIVSNCVVNLSPDKDAVLRGVHRLLKKGGEFYFSDVYADRR
VPDAVRNDPVLYGECLGGALYWNDFIRLAQRHGFADPRLVEDRPLDITDPKLAPRVGNLK
FFSATYRLFKLDNLETACEDYGQAVIYRGSIPDHPDAFTLDKHHRIETGRVFPVCGNTWR
MLQDTRFAAHFEFIGDFGRHYGLFEGCGAAIPFDAKTGTEASCACC
Download sequence
Identical sequences D9SHB5
gi|302879112|ref|YP_003847676.1| WP_013293845.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]