SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302879143|ref|YP_003847707.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302879143|ref|YP_003847707.1|
Domain Number 1 Region: 25-219,282-305
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.0000000000187
Family Hypothetical protein HI0319 (YecO) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302879143|ref|YP_003847707.1|
Sequence length 329
Comment methyltransferase [Gallionella capsiferriformans ES-2]
Sequence
MRSESPTPSPDQEKKDFLCSVREGLRSRPKTIPPKYFYDAHGSHLFDLICTTPEYYPTRT
ETAILEHHSEEMAEMIGTSSTLIELGSGSAIKTPLILRHLSHDAVYVPIDICEPHLRNST
QRLQTRFPALKMQPLCADYHRLPAHAIKHHVGRRKVVFFPGSTIGNCTPDEAVTLLKRVA
ALVGPGGGLLIGVDAKKSTETLNAAYNDAAGHTAAFNRNLLTRMQSELGAQLDADQFAHH
AYYNEPHGRIEMHLVSRCKQAIRLDGESFEFDEGESIHTENSYKYSAQEFKQLARTAGWH
LQSNWHDENELFNVHYLSQSAAEPLKLAR
Download sequence
Identical sequences D9SHE6
WP_013293876.1.12990 gi|302879143|ref|YP_003847707.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]