SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302879170|ref|YP_003847734.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302879170|ref|YP_003847734.1|
Domain Number 1 Region: 172-356
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.66e-70
Family Methylesterase CheB, C-terminal domain 0.000000642
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 2.99e-27
Family CheY-related 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302879170|ref|YP_003847734.1|
Sequence length 363
Comment response regulator receiver modulated CheB methylesterase [Gallionella capsiferriformans ES-2]
Sequence
MSKIKVLVVDDSAVVREVVKQVLESDPGITVYATAMDPIFAMEKMKLQWPDVIVLDIEMP
RMDGLTFLNKIMNERPTPVVICSTLTEKGAQATMQALAAGATSIITKPKMGVKRYLQEDA
SNDLVGAVKAAARANMRRLTNTQQRPPVPSQKLNADAILPPPGAARLGMTSEQIVAIGTS
TGGTQALEAVLTALPRVCAGIVIVQHMPEMFTEAFAQRLNSLCQIEVKEAKNNDRVIPGR
ALIAPGGKHMLLKRSGAQYHVEIVEGPLVNRHRPSVDVLFRSVAKFAGKNALGIIMTGMG
DDGARGLKEMRDAGAYTLGQNEDSCVVYGMPKEAMKLGAVCEELPLQQIAGKISAVHAMV
SGR
Download sequence
Identical sequences D9SHH3
WP_013293902.1.12990 gi|302879170|ref|YP_003847734.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]