SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302879176|ref|YP_003847740.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302879176|ref|YP_003847740.1|
Domain Number 1 Region: 881-1127
Classification Level Classification E-value
Superfamily EAL domain-like 3.01e-89
Family EAL domain 0.0012
Further Details:      
 
Domain Number 2 Region: 705-868
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.8e-46
Family GGDEF domain 0.00014
Further Details:      
 
Domain Number 3 Region: 586-697
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.47e-28
Family Heme-binding PAS domain 0.054
Further Details:      
 
Domain Number 4 Region: 439-566
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.7e-26
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.011
Further Details:      
 
Domain Number 5 Region: 342-450
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.07e-24
Family Heme-binding PAS domain 0.013
Further Details:      
 
Domain Number 6 Region: 79-192
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.79e-22
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.06
Further Details:      
 
Domain Number 7 Region: 186-321
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.7e-17
Family N-terminal PAS domain of Pas kinase 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302879176|ref|YP_003847740.1|
Sequence length 1134
Comment PAS/PAC sensor-containing diguanylate cyclase/phosphodiesterase [Gallionella capsiferriformans ES-2]
Sequence
MTLWRMNTEFKPLLLRQLHELGLDAEHLPDIDSWRSLLSIIEQTYHEARCVTGRSLAVPS
TEMQYPHPRGTDEARLRTLFNTIKDLVWLKAPDGVYLACNPVVERMLGTAEAAIVGRTDY
DFISREQADSFREHDRAAMNTGTVCINEGWLTFKDTGYCGLFETSKTPVYDDTGQLIGVF
GIARDITERKRAEAALKNSEQQARNLIDKLQVGVLLQSARAEILLCNQIALDLLGLSEAQ
LLGKSSFDPDWNVIHEDGSPFPGSEHPVPVSIATKSLVHDVVMGVYRPSKRDRVWLLVSA
APQLNPNNEVEQVVCTFVDITERKKMEERLELTQFASDYAPDCILWVNEQARICYANEAA
LHCHGFSKEELLSMTIHDLDPDFPPDVWLAHWHELQHKGGITIETRHRRRDGSIFPIEVS
ANFVKFGDKEYNIAYHRDITERKKSEAALRYSEQRLRDVSEASGEYLWEIDINLGYTYVS
NRSIEVKGYTPEQLLGHAPAEFMPPEDIDMAARIVNLAISKNQPFKLQHRDITPSGAILW
EEVSGVPFYDDAGHLLGLRGTGRNITGRKLKEEQLRVAAAAFETHEAIMITDAHGTIIKV
NQAFQRITGYSQEEVLGENPRILSAGRNEKSFYSAMWQQLTTLGRWRGEIWDKRKSGQIY
PKWMTITAVRDENGKTTEYVAIFSDITQRKLAEEEIRNLAFYDALTRLPNRRLLLDRLHA
ALSVSARSRRFGAVLFLDMDRFKTLNDTMGHDYGDLLLIEVAERIKLCVREIDTVARLGG
DEFVILVEEIDTRAEETSKHIAAIAEKIRSALSVPYRLKEKHHHSSPSIGVCLYRGIEES
TDDLLKHADMAMYQAKDSGRNAVRFFDPLMQQAVEARVTLENDLRHALPNDQLQLYYQIQ
VDNDRRAIGAEALVRWIHPIRGMVSPAHFIPIAEETSLILEVGAWVLKTACLQLAVWADR
PMTCNLILAVNVSVQQFKQVGFVEHIAELIRAYCIVPQRLKLELTESVVLNDVSDIVQKM
CALKSLGVRLSMDDFGTGYSSLSYLKNLPLDQLKIDQSFVRNIATDENDAVMVKTIIAMA
QNFRLNVIAEGVETEAQLAFLKQNGCMCYQGYYFGKPAPIEQFQSQLEALSKTV
Download sequence
Identical sequences D9SHH9
gi|302879176|ref|YP_003847740.1| WP_013293908.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]