SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302879268|ref|YP_003847832.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302879268|ref|YP_003847832.1|
Domain Number 1 Region: 554-731
Classification Level Classification E-value
Superfamily GAF domain-like 1.16e-24
Family GAF domain 0.0069
Further Details:      
 
Domain Number 2 Region: 740-865
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.38e-23
Family Heme-binding PAS domain 0.038
Further Details:      
 
Domain Number 3 Region: 430-556
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.55e-19
Family Heme-binding PAS domain 0.059
Further Details:      
 
Domain Number 4 Region: 332-439
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.22e-19
Family Heme-binding PAS domain 0.013
Further Details:      
 
Domain Number 5 Region: 987-1114
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.09e-18
Family PYP-like 0.096
Further Details:      
 
Domain Number 6 Region: 1219-1339
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.67e-18
Family Histidine kinase 0.0074
Further Details:      
 
Domain Number 7 Region: 886-999
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.33e-16
Family Heme-binding PAS domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302879268|ref|YP_003847832.1|
Sequence length 1343
Comment multi-sensor signal transduction histidine kinase [Gallionella capsiferriformans ES-2]
Sequence
MLGGYLVFQGYKEDIKQQQLGVLSGIARLKTRQLVNWMGERREDAFELQRDDLFVEAVDH
WLQHTDDKTGGRLAQRLIKQRQHCASYGCDSVSLFDDKARLRLSSNKGKSPLLESQRARL
LDSIQRGNIAFSDLKSAVTDSGAGIDIELIIPLRQISNGQFRTLSAIVFRIDPKRFLFPL
IQDWPTPSSTAENLLVRRDGDQVLYLNELRHLRNVPGDFRLPLNPELPASMAVLGREGVA
EGVDYRGVPVVSVVGRVEGTSWFIVSKVDKSEIYAPIHRLVNWMLLLMAFLVVSGIGVVA
YGWRKEKKQSRRDFEHQMVMKRLHYLSKYANDIILLVDEKGKIVDFNDRAMASYGYTAEE
FSTLSIFDLREKRWASTVAEDFRKTMESGAMRFDSVHLRKNGETFPVETSTRVVDIDGKQ
FQQAIVRDMTERHRAQGELIRQKEFIRQVMDGNPNLIFVKDAGGHFLLANEAMARRYGLT
TESIIGKCSSDLTCDLLELSEITQANRDVIENCREWVAIERHLSRDNQVHWFQTVRKPLK
QPDGSVHVLIIAVDITELKQAEVQQNRLNRALRLLGACNQAMLHSTDEIGLLNEICRLVV
EVGDYLMAWIGYAEQDENKRVSMAARYGNDAGYLEQSQISWADTEWGRGPVGLAIRNGVT
QVNQDFQSTAALAPWSEAALERGFHSSIALPLKANGCVLGVLALYSSEPYAFNEDEISLL
EDLAVNLAYGIGVLRGDELRNRVQTQLNDERMRLQTLLKTIPDMIWLKDREGVFLNCNAQ
FERLFGAREADIVGKTDYDFVDADLAEAFRQKDKEAMASDKPVINEEWVRFADADEPVLL
ETIKTTLRDERGGMVGVLGIARDITERKLAENREIRLRHILDSTLDMIFIFQLDTLNFVY
ANKEAINSVGYGNSELRTMTPADITPLMPEAEFRKFISPLLTREKLMLRFETVHRHKNDA
EFPVEVQLELVEELGGERVIVAVVRDISERLEAEKEIRRQKNFMWRVIDTDPNCIFVRDA
AGKFLLANQSSADLLGLMPKEMIGKTLAEIAGVSYEQTVFSGGDDDVIERGREISQIEPY
LLEDGEQRWQLTLKTPLTMPDGESSVLCIAMDITQQKLSEIKLADSYRELQQLSLHLENI
RADERARIALNLHDEMGATLVAIKMGLVWLASKLPADAQQLSDEITRLIELSVDGMHVMR
QVVTELRPNLLADMGISAAIKDYVKKFCQHMKIECVLSLPDSVLSLDEKQSLTIFHIVQE
ALNNVAKHGKSTRVTVHITIRRKSILIVVGDNGIGFNQVEQKGRSFGLLSIRERALMLGG
KARVSSAPGKGTRVSVCIPYEGE
Download sequence
Identical sequences D9SHX7
WP_013294000.1.12990 gi|302879268|ref|YP_003847832.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]