SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302879377|ref|YP_003847941.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302879377|ref|YP_003847941.1|
Domain Number 1 Region: 4-167
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 7.6e-27
Family CAC2371-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302879377|ref|YP_003847941.1|
Sequence length 206
Comment type 12 methyltransferase [Gallionella capsiferriformans ES-2]
Sequence
MDSKQHWEQVYATKPSDSVSWFQEHADQSLRLIHNTGLGKDAAIIDVGGGASNLVDDLVA
EGYTDLTVLDLSSAALTVAKQRLGKQADAVHWMEGDITRAEFSEHRFDIWHDRAVFHFLT
DPADRHAYVERVMHAVRPGGHVIVATFAADGPEKCSGLPVMRYQPESLHAEFGDAFLLVA
HEKEVHHTPFGTDQQFVYCYCRKGNS
Download sequence
Identical sequences D9SIL4
gi|302879377|ref|YP_003847941.1| WP_013294108.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]