SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302879430|ref|YP_003847994.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302879430|ref|YP_003847994.1|
Domain Number 1 Region: 159-318
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.33e-49
Family GGDEF domain 0.0000744
Further Details:      
 
Domain Number 2 Region: 13-84
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000143
Family Heme-binding PAS domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302879430|ref|YP_003847994.1|
Sequence length 337
Comment PAS/PAC sensor-containing diguanylate cyclase [Gallionella capsiferriformans ES-2]
Sequence
MNPATHVQNLVWNSIWNAINLGLILIDNQGVVVIWNDWVSEHSGITEKQAVGQTLESLFT
DGLGASFKTAMQNALTYKLPVVLSSVLHRSPLPLYPLPCTRQKQQARIHQSVSLTPIITP
DGAHQCLIQITDTSVSFTREHMLKSHSKQLSIDATTDGLTGAYNRRYFNERFKAEFGRVN
RQGTPLALLMLDIDCFKDYNDFYGHPAGDRVLIRIVERIKSQLNRTTDVVTRYGGEEFAI
LLPDCELEGARAVAQKIQHAILTLNIPHAKSNVADHVTLSIGIATHSVNSSCDANFLLNT
ADTALYTAKHEGRNCIRYLLTSEKISLDAACLVDLGD
Download sequence
Identical sequences D9SIR7
WP_013294154.1.12990 gi|302879430|ref|YP_003847994.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]