SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302879443|ref|YP_003848007.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302879443|ref|YP_003848007.1|
Domain Number 1 Region: 679-847
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.41e-42
Family Histidine kinase 0.0015
Further Details:      
 
Domain Number 2 Region: 1007-1135
Classification Level Classification E-value
Superfamily CheY-like 1.1e-36
Family CheY-related 0.0023
Further Details:      
 
Domain Number 3 Region: 259-434
Classification Level Classification E-value
Superfamily GAF domain-like 8.07e-20
Family GAF domain 0.005
Further Details:      
 
Domain Number 4 Region: 446-561
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.9e-20
Family Heme-binding PAS domain 0.02
Further Details:      
 
Domain Number 5 Region: 612-691
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 2.35e-18
Family Homodimeric domain of signal transducing histidine kinase 0.0016
Further Details:      
 
Domain Number 6 Region: 1105-1118,1153-1253
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 6.15e-16
Family Chemotaxis protein CheA P1 domain 0.05
Further Details:      
 
Domain Number 7 Region: 867-983
Classification Level Classification E-value
Superfamily CheY-like 0.000000000138
Family CheY-related 0.019
Further Details:      
 
Domain Number 8 Region: 148-263
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000349
Family Heme-binding PAS domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302879443|ref|YP_003848007.1|
Sequence length 1346
Comment multi-sensor hybrid histidine kinase [Gallionella capsiferriformans ES-2]
Sequence
MKSNLTFKLIVAMTIPFIAAGAQWILWPYLNPLVWFAFFPAVFLSARIAGLWGGISGTLL
STLLAWYLFIPTQLSWRLEHSNSMFSMLMFLLIGYAISIYLHRLTRAGQEIRAALNPTLA
ACDKTTQGMPQTSSAPLWGADILQQSMLNSLVESVLVFSPEGKILACNRAAELFFGCSLE
TIQSNLRPVQLLHENGTPFLEEDIPVNITIRTKAACRNVPVGYADLSGMVRWVLANCEPV
IEPLTGEIKAAVLSLLEISEQKKNADEQLRLNRTLRAYSASDWALVHATDESAYINQVCQ
ILVEECNYVMAWVGFAEHNPEKTVRPVGKAGDDTGYLDEITISWEDNEYGSGPSGRAIRT
GKMVVCHHMLSDPTFIPWRAQAQQRGYAASISLPLIANEQTLGAIMVYSSIADPFVNEEL
KILQELANDLAYGIAVLRIRAAHADQEQALRASELRYRLLVEQTVDGIFLANAQGQYIDV
NQAGAAMLGYSTVEICTLNISDVIAIEEIGRIPDEVARFKNGSVVVSEWQFKRKDGSIFL
GEVVGRQIENGCIQGILRDITFRREAENELQRARLAALNLAQDALEARAKLEILNDSLES
EISDRKLALKDLEIARNAADLASRAKSDFLANMSHEIRTPMNAIIGLTRITLDSELAPKQ
RDHLRKVYNASRALLNILDDILDYSKIEANKLEIERVEFILEDVIRECFDLFMQKLQEKE
LELFIEIDPLISCSLLGDPLRLGQILNNLINNAIKFTQRGEIHIRAALISENNQTLNLKF
SVRDTGIGMDQSQQDRLFNAFTQADSSITRKYGGSGLGLTISKRLVELMGGALSVASEKD
IGSEFTFNAYFERCASLEILSSVHRLNPMRVLIVDAHPTSQKVLIHYFGALSFDITATTS
VEEAIARSSALPQFDLLITNHCSQDATNRLHDLQKTAAIAVSASILMVTANDRENHLETH
NEIILTKPATLSKLINALLKIQQPEFPSTFALPERRIDLYQLAAPIRGAHILLVEDDEIN
QEIATEFLVRSGLIVVTANNGAEAFALVQQQAFDAVLMDIHMPVMDGFESTRLIRTLAQG
KTIPIIALSASAMAHEKLNSSSAGMSDHVSKPFDPAQLITTLLKWIAHKPPHHSEPNVNM
SARTPVPAPHQLSGINYADALSRLQGNENLLNRLLQRFATEHTTFSQQLENLLQEQLFDK
ALSALHRIRGTASTLGVNELTACAMKLESEIKAQEKLNSLPEFIACLGAVIEQIHKNVSG
ENRLINPCTHPDQPMVETYLANLAICIENHEMFDEDMLTALLSNLGSYIPRKLVAQLESQ
LNNFDFNQAELTLVKIRDTWKSVHNI
Download sequence
Identical sequences D9SIT0
WP_013294167.1.12990 gi|302879443|ref|YP_003848007.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]