SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302879489|ref|YP_003848053.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302879489|ref|YP_003848053.1|
Domain Number 1 Region: 611-780
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 9.04e-46
Family Histidine kinase 0.00069
Further Details:      
 
Domain Number 2 Region: 942-1061
Classification Level Classification E-value
Superfamily CheY-like 1.71e-37
Family CheY-related 0.0029
Further Details:      
 
Domain Number 3 Region: 302-403
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.31e-31
Family Flavin-binding PAS domain 0.015
Further Details:      
 
Domain Number 4 Region: 801-925
Classification Level Classification E-value
Superfamily CheY-like 1.04e-27
Family CheY-related 0.01
Further Details:      
 
Domain Number 5 Region: 542-624
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.63e-23
Family Homodimeric domain of signal transducing histidine kinase 0.0016
Further Details:      
 
Domain Number 6 Region: 403-535
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.61e-21
Family Heme-binding PAS domain 0.094
Further Details:      
 
Domain Number 7 Region: 1041-1166
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 0.0000000000000236
Family Chemotaxis protein CheA P1 domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302879489|ref|YP_003848053.1|
Sequence length 1179
Comment multi-sensor hybrid histidine kinase [Gallionella capsiferriformans ES-2]
Sequence
MKRSIKQNAWQVFIAFAAIAGLLLLFVKAQAVDPDIHNQVVSDIAELQKRDTELGEAVLQ
LHYRLANNYDAVTALMQRADVLANRLEAHQNNGWLPDSPEARRELAGLRVQIEQRSNQLD
EFKSNNAVMKNSLIYLPSMVGKVLALLPYETEVTLEKFEFLLRDALLVSVKGDEASIAQL
AVDINRAEQAIPGLPAKAQGVAVYVVRHAQTLLSVARIMPGLLADLSAYKGEHLAAGLDR
LYQVHYEQQQRTANIYRLFLLFAALLMLAYSIFVYFRLKVKGQQLERALAEVSNQQHALN
EHAIVSITDVKGDITYVNDKFIEISGYSADELIGKNHRMVNSGQHDQEFFRELWQTVANG
RVWHGQVKNRAKNGSCYWVEATVVPFMDQDGKPYQYVSMRTDITAQKAMELQVQSERRLL
KSVMDTLGEGVYMLDQDGNCTYMNTEAEDIVGWTIEEVVGRNLHDLLHVHRPDGTRVTAD
ECPIRQSTMNKKVYHSEAEYFQHKNGTLFPIAIVASPMIDGDLITGSVAAFQDISERKFT
ERELLRAKESAEAASRAKGDFLATMSHEIRTPMNGIIGMTELALDTEMSAEQREYLNMVK
SSADALLTIINDILDFSKIESGKMELESVEFDVRNLFASAEKTLAIRAAQKGLELVYDVD
GAIPDLLVGDPGRLRQVLTNLLGNAIKFSEHGAITLRMKLLMQTSDGLCVRIEVADQGIG
IPVDKLAHIFEAFTQADTSTTRKYGGTGLGLAISSKLVAAMGGDLSVESQVGIGSVFGFT
TTLPVALNQPSEISCESLVNLSALIVDDNATNCKLLSQQIKKWGMRPTVAGSASEGMAML
REAQQEQAPFDLLLLDAVLSDADGFDFAAQLQSMPQKPRALVMMLSSASLRADAERCRQA
GISNYLSKPIDRWELIKTIKAALGLQVDDVFVQTAPLASAHSLNILLAEDNRVNQKLAIT
LLGKWGHRVVLANNGIEAVEHAGRVDFDVILMDLQMPEMSGMEATRLIREQDQLRGRHSR
IVAMTANAMSEDRQRCLDAGMDDYIAKPLNTEKLRALLDGMESADVAEKVTVYDYRAALN
TADAWVVETIGQAFLDECDPQMAAIDSAIKSGDKVLLMRGAHTLRGLVGNFNARKIEEIS
AKIEQLANSDDLLSASGYFEQLQVEMELFKSALIAYLEK
Download sequence
Identical sequences D9SJA1
gi|302879489|ref|YP_003848053.1| WP_013294212.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]