SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302879536|ref|YP_003848100.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302879536|ref|YP_003848100.1|
Domain Number 1 Region: 546-717
Classification Level Classification E-value
Superfamily Nucleotide cyclase 2.82e-47
Family GGDEF domain 0.00017
Further Details:      
 
Domain Number 2 Region: 402-528
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.85e-24
Family Heme-binding PAS domain 0.012
Further Details:      
 
Domain Number 3 Region: 332-380
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000902
Family HAMP domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302879536|ref|YP_003848100.1|
Sequence length 720
Comment PAS/PAC sensor-containing diguanylate cyclase [Gallionella capsiferriformans ES-2]
Sequence
MKLKTRIFILMSVIFAAFMVTIALYSSYLVTQLNERWGARVTEKQVLFDKHRTLQPLLRE
IGLARQLAAEPAMLEMALHEGSVKAQEAGIAVLEQYRMRFQDHSYFAAIIKSGHYYFNDD
DAKQFGAQQLRYTLSRKNPDDAWFYATVESDREYQVNVDPDAHLGNVKVWINVAVKQGNR
VVAVIGTGIDIGEFLKGTVDDTQVGIDNLFIDRDMAVQLHADQTLIDYASLTKAVDQRRK
VDVLLRDPSDLARLRAVMHRLESAPDKIETLWVNYEGRKRLLGVAYLPAIGWFDLTLIDG
GTLGLLEQFYFIPVFAVLFLLGLLATGIMLHRLVLKPLYKMGLSIEQIKAGNYDIDVPQT
GTGEIAELSAEFRNMLDVVRNTKQDLENTVAHRTAQLSLELAERRRVEDDLRRSETKFRQ
LFELSPIGLAMVDYETGKFLEVNHSVLESIGYTKAELLALNCRDVTPVEYESQEREQIDS
LNRTGYFGPTIREYMRKDGSRYPIEIRGFRLTDSDGKMCVWGIVEDITERTQFEAQIRQL
AYYDTLTQLPNRRLLNDRMNQVIASSRRSGCHAALMFLDLDNFKPLNDTYGHAVGDLLLV
EAASRLKNCVREMDTVARFGGDEFVVMLSELDRGQAGAAAEALNVAEKIRSVLSQSYSLT
ISREERVDTLVRHHCTVSIGVVLFVDHQGSQDEVLKWADAAMYQAKDGGRNQIRFYEAPV
Download sequence
Identical sequences D9SJE8
WP_013294259.1.12990 gi|302879536|ref|YP_003848100.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]