SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302879537|ref|YP_003848101.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302879537|ref|YP_003848101.1|
Domain Number 1 Region: 900-1147
Classification Level Classification E-value
Superfamily EAL domain-like 7.59e-88
Family EAL domain 0.0021
Further Details:      
 
Domain Number 2 Region: 723-886
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.88e-47
Family GGDEF domain 0.00022
Further Details:      
 
Domain Number 3 Region: 602-704
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.9e-28
Family Flavin-binding PAS domain 0.041
Further Details:      
 
Domain Number 4 Region: 360-450
Classification Level Classification E-value
Superfamily Sensory domain-like 0.000000353
Family Sensory domain of two-component sensor kinase 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302879537|ref|YP_003848101.1|
Sequence length 1157
Comment diguanylate cyclase/phosphodiesterase with PAS/PAC and MHYT sensor(s) [Gallionella capsiferriformans ES-2]
Sequence
MLERFSLLFSSPENSVLYAGNYDFLLVTLSVAVAIFSSYAALLVSNNIVQCKRPLTRRLW
LAGGSLCLGVGIWAMHFIGMLAFNLPCSSSYDARLTLLSMVPGILASMLALSLISRHDIS
NLKLVAGGVLLGSGIGAMHYAGMAAMRIDGMIRYDVRLFLISILVAVVLAILALWINFRL
NARRSVWSRWSAFFSALIMGLAVSGMHYTAMAAAYFIRVETPAGSSAGMSPNFLTGIVLA
ASGLIIIVTIVATFVRKSNLLSLGRAYKTIALFIVIWTCMAWLGADYYYSRRANNLYQQE
VQIATQQAENIAFSINENIELLKGISRVFTRDVELREALHSNLQIKRGMNVFGELNRSLQ
ISALNLGADNIFVLNARGDCIAAANAGEPASPVGTNFADRAYFPEVKAGKSGRQYAVGRT
SNVPGLYYASPIFENGRFLGAVVVKRDITKFASLIKQSHALISDTNGVIVLSYDQAYLFQ
AMPEAAVLTMSVEQKLLQYRRAVIEPLQMKSWGKPQFAAAVLVGNKPQVLVSKALPDDEI
TVHVPRSVGILVRLANEKNWLFLLLAATGSMLIIAVSVVVIYLRDSLRAAADLRVSATAF
DAQEGMFVTDAEGVIQRVNNAFTQLTGYSASEVIGQTPRLLSSGQHDAVFYALMWQSINE
TGKWAGEIWNRRKNGEIYPEYLAITAVKDESGVVNNYVATFNDISDSKAATNEIQLLAFY
DALTGLPNRRLLLDRLLQALASSVRSNRMGALLLIDLDNFKTLNETMGHDIGDLLLRQVA
ERLTACVRNGDTVARLGGDEFIVMLEEIGAQTVDSVTHTTTIAEKILNSLNLPYRLEKHE
CHSTPSIGATLFSGTQQSADELMKQVDIAMYQAKQAGRNGLRFFDSKMQDAISARASLEA
DLRVALINSEFQLHYQIQVNSLGAALGAEVLIRWMHPQRGMVSPAQFIPLAEESGLILPV
GEWVLKTACHQLKVWQDNALTRELTLAVNVSSKQFRQAEFVELVKKTLQSSGANPSLLKL
ELTESLLLENIDEIIAKMNELKLMGIHFSIDDFGTGYSSLQYIKRLPLDQLKIDQSFVRD
IMDDNNDAAIVQTIIAMSDALGLNVIAEGVETREQRAFLDSHGCHTFQGYLFSKPIPLEQ
FEILLATKHAAGMPTER
Download sequence
Identical sequences D9SJE9
gi|302879537|ref|YP_003848101.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]