SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302879640|ref|YP_003848204.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302879640|ref|YP_003848204.1|
Domain Number 1 Region: 332-492
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.88e-34
Family Histidine kinase 0.0021
Further Details:      
 
Domain Number 2 Region: 268-343
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000000137
Family Homodimeric domain of signal transducing histidine kinase 0.0025
Further Details:      
 
Domain Number 3 Region: 124-260
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000155
Family GAF domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302879640|ref|YP_003848204.1|
Sequence length 505
Comment integral membrane sensor signal transduction histidine kinase [Gallionella capsiferriformans ES-2]
Sequence
MKFLRFFSTFPQPHSPCARMLWAVIACVIATLLAWPWRDFLDPANTAMLYLLAVAVVAAR
AGKGAAIAAALLGTALLDFFFIQPRFTFTVGDVQYAVTLAVMFAVALIIGNLTQGLQREK
EAAQERERQSNALYQLASQLAGALTLEQIEGMTRRFLHETQSCQSQLLMRHGEEMSPVIP
GQTPLSGKPYYAVKAALQQGAAQATLDGALHWLILPLHDTPQARGVLVLSFYDVGLLGNE
RRPLFKAIAALVAASVERLHFVEIAQQAQLQMTDERLRNSILSALSHDIRTPLTVLYGMA
DTLAQSALPQALHEMADAMRQQTFRLNSMASNLLDMAKLRAGDIRLNLEWQPVEEVIGAS
IKLLGPALAQHPVSVVLPADMPLLRFDAVLMERVLCNLLENAAKYAAPGSSIRIAVRADQ
KFAHLSVCNEGSQFPIDRLERLFELFERGDIESNVPGVGLGLAICRSIVSAHGGSIYADN
DAGACVTFTLTLGEPPVIETEDEYE
Download sequence
Identical sequences D9SK28
WP_013294360.1.12990 gi|302879640|ref|YP_003848204.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]