SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302879698|ref|YP_003848262.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302879698|ref|YP_003848262.1|
Domain Number 1 Region: 261-425
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.14e-43
Family Histidine kinase 0.0018
Further Details:      
 
Domain Number 2 Region: 193-273
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 4.12e-21
Family Homodimeric domain of signal transducing histidine kinase 0.0005
Further Details:      
 
Domain Number 3 Region: 85-197
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000182
Family Heme-binding PAS domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302879698|ref|YP_003848262.1|
Sequence length 430
Comment histidine kinase [Gallionella capsiferriformans ES-2]
Sequence
MQEFWIRVSMPIIFSALVALLLWGIFSANIALIFLLVVMLLVMMRHARQLYRLGEWLKEA
RIETIPEAGGIWDELFSRLYKMVKRHKLTKQKLANELLNIEQATAALPEGVASLNEANRI
EWCNPLAEHHFGLNAQRDIMQDITYLVRQPEFIDYLQAGDFAAPLVMRSARHDDMVLSIK
LVFYGDNKRLLISRDITQLERIETMRRDFVANVSHELRTPLTVVNGFVENLQDMPDLSHD
KIQRALQLMAEQTRRMDHLVSDLLTLSRLESDQSPLKIESVDMYSLLSEVSLDGEMLSGG
RHQHSMDATGPAKLSGNRDELRSAFSNLVSNAVRYTPDGGTISLRWYSRAGQPVFSVRDS
GIGIEAQHIPRLTERFYRVDRSRSRETGGTGLGLAIVKHIALRHQAKLEVCSEEGRGSTF
SLVFPEKRIV
Download sequence
Identical sequences D9SK86
WP_013294418.1.12990 gi|302879698|ref|YP_003848262.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]