SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302879727|ref|YP_003848291.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302879727|ref|YP_003848291.1|
Domain Number 1 Region: 641-890
Classification Level Classification E-value
Superfamily EAL domain-like 1.22e-93
Family EAL domain 0.0019
Further Details:      
 
Domain Number 2 Region: 465-628
Classification Level Classification E-value
Superfamily Nucleotide cyclase 4.71e-50
Family GGDEF domain 0.00052
Further Details:      
 
Domain Number 3 Region: 346-457
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.19e-26
Family Flavin-binding PAS domain 0.039
Further Details:      
 
Domain Number 4 Region: 88-201
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.92e-24
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.016
Further Details:      
 
Domain Number 5 Region: 197-326
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000314
Family Heme-binding PAS domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302879727|ref|YP_003848291.1|
Sequence length 900
Comment PAS/PAC sensor-containing diguanylate cyclase/phosphodiesterase [Gallionella capsiferriformans ES-2]
Sequence
MKKESRLALRLALIYAAFGLLWISLSDRFLASVITDSASLTKFQTYKGFCYVVITSALVY
FLAKQTMKQNFLTEEKLHDSEERWKFALEGAGDGVWDWNPQTDEAFFSKRWNEIIGYTEH
EFPATGSAWVAHLHPDDKDRVLSVIQGYLTDSREIYDVEYRIRCKDGSWKWILARGMLVS
RDVYGKPLRMIGTHSDITQRKVDEELVLKNLEKWKKLFDILPIGVSIVNSKNGIVDFNPS
LEAILGISKEGLLQGDYDNWEYLRTDNTHMDADEFPSLRAIKEQRVVKDVVIGVKKESGD
IIWTSVSAAPLSYDSNSCVTVTTDITKRKQFESELRVSATAFETQEGILITDENNVMLRT
NAAFTAITGYTNKEAIGQNPRLLSSGRQNASFYSAMWKAINTTGVWEGEIWNRRKNGEIY
PEHLTVTAVKDRNGMVTNYVGVLSDLTQRKAAEEKIENLAFFDPLTKLPNRRLLLDRLKQ
AMASATRSVTNGAVLFIDLDNFKALNDTYGHPMGDLLLQQVAKRLVSSVRDGDTVSRFGG
DEFVVLLEGFDENPLDAASQAETVGEQIFAALRQPYLIGTHEYHGTSSIGATLFNDKQQS
IDELMKQADIAMYQAKKEGRNVLRFFDPQMQETIAKRTALEGDLRKAIENHQFQLHYQIQ
VDESRHPFGAEALIRWFHPEHGMVSPDQFIPLAEESDLILPIGYWVLETACARIQRWQHD
AKTSGFVLSVNVSAKQFRQTDFVNQVQSLIQQYEINPSLLKLELTESMLLDNIEDTIATM
SALKELGVKFSLDDFGTGYSSLQYLKRLPLDQLKIDQSFVRDIAVDASDRAIVRTIIAMA
HSLDLDVIAEGVETEEQQKHLSSKGCKNFQGYLFGKPVPIEQFETSLRKSLFQPADSCHE
Download sequence
Identical sequences D9SCE6
WP_013294447.1.12990 gi|302879727|ref|YP_003848291.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]