SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302879751|ref|YP_003848315.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302879751|ref|YP_003848315.1|
Domain Number 1 Region: 9-204
Classification Level Classification E-value
Superfamily GAF domain-like 2.84e-30
Family GAF domain 0.001
Further Details:      
 
Domain Number 2 Region: 201-279,407-478
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.0000000000066
Family HD domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302879751|ref|YP_003848315.1|
Sequence length 543
Comment metal dependent phosphohydrolase [Gallionella capsiferriformans ES-2]
Sequence
MSANTNLVSRLKEINEIGIALSYQPDINSLLELILEASKRITHADAGTLYLHDPVHKTLR
FEIVRTDSLSIAMGGVGGAPISFMPVDLYDKEGRPNHATVVSHTALSGETVNILDAYTAQ
GYDFSGTKKFDAKTGYRSRSFLTVPMINHEREVIGVLQLINAQDRESGEIVSFSTEDRQL
VESLASQAAIALTNRRLIRQMEELFEAFIQLINTAIDDKSPYTGGHCERVPLLTMMIADA
ITRTETGPLKGFVMTEEDQYELKIAGLLHDCGKITTPVHVVDKPTKLHTLFDRIDLIVTR
FEVLKRDAEIEMLKKLCDGSRMEDAERDSIRAEYAARIRQLDDDREFLRLSNIGVEKMPE
ADRQRVLSIAAYQWRDSTGQMTNFLTDNEVENLNILFGTLTGAEREIINRHIDVTIKMLE
SLPWPKHLKNVPEYAGGHHERMDGKGYPRGLNREQMSLQARIMGIADIFEALTAKDRPYK
SGKTLIESLTILGKLKLNGHIDPDIFDVFIREKVYVEYVKLFLSPEQIDEVDLNTIPGIN
LGA
Download sequence
Identical sequences D9SCH0
gi|302879751|ref|YP_003848315.1| WP_013294471.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]