SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302879752|ref|YP_003848316.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302879752|ref|YP_003848316.1|
Domain Number 1 Region: 372-676,709-787
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.77e-81
Family RecA protein-like (ATPase-domain) 0.000000109
Further Details:      
 
Domain Number 2 Region: 17-186
Classification Level Classification E-value
Superfamily GAF domain-like 9.38e-25
Family GAF domain 0.00045
Further Details:      
 
Domain Number 3 Region: 196-331
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.0000000000418
Family GSPII protein E N-terminal domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302879752|ref|YP_003848316.1|
Sequence length 791
Comment putative phytochrome sensor protein [Gallionella capsiferriformans ES-2]
Sequence
MRSAVNNDEDIGAKLEFTKNLNHVINKIHATSNIDEIMLDVSRDICALFNADRLTIYVVG
DDGVSLISKVKTGLNSFKDLKLPIAEQSVAGYVAVNKKLLNIEDVYDEQELSRYSSHLRF
LQEVDRRTGYRTKQMLVAPILDAGSNELVGVIQVINNKAGVPFSALVEDGVHELAHTMAV
ALRQRQEKALVKTKYDYLVGDAVLSAAEFELATRTARRKGVDIEEVLLDEFQVSAAPLGK
ALSSFFGVVYEPYKADRIKPPDLLRNLKREYVESSHWLPIEETQEGVVILTTDPERIQTS
RVVNNIFPRNRLVYKVCSQREFKKTLDLFYGGGESSATGGMDESSMDDLLSSMGGDEEEI
SSLTQDDVNAAADNELVKLVNKIIVDAYRMGASDIHVEPQPGKAKTQIRLRKDGSLLNYI
EVPSTYRNALVTRIKIMCDLDISEKRKPQDGKIKFKKFGPLDIELRVATIPSQGGVEDVV
MRILASGEPLPLEKMGFSERNSELIKNTVSKPYGLFFVCGPTGSGKTTTLHSILKFINKP
ETKIWTAEDPVEITQKGLRQVQINKKAGLDFPTIMRAFLRADPDVIMVGEMRDKETVSIG
IEASLTGHLVFATLHTNSAPESILRLLDMGMDPFNFADALLGILAQRLAKRLCGDCKKPH
LASEDEIQAMLKEYSEELKYTVSWKMDEAGARAALFEQWLKLFANDKKQFTLYTPVGCEK
CAGTGYRGRVGLHELLIGSDSVKKAIQERARVAELLAIALDEGMHTLKQDGMEKVLQGIT
DMHQIRAVCIK
Download sequence
Identical sequences D9SCH1
WP_013294472.1.12990 gi|302879752|ref|YP_003848316.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]